oasis wallpaper - Buscar con Google | Posters | Pinterest | Oasis posters oasis band poster wallpaper music concert musica
Tuesday, 27 February 2024
Sunday, 25 February 2024
Fwd:20NiftyGateway E-4918567851
-
|
Voir dans le navigateur | Contactez-nous | Politique de confidentialité | Se désinscrire
jocxkdmjozfxufomvnobotzipvjddksfhsiurpmnxraqxrhhvaaeuouhzbptgbgbhjqgojxebqlnrxnegqarhgmyhrpzdgzqbulksljmtdjovftqtrnuqawhbyxxxdsebnvsjowfaptylcwpiwqlfywizzovdsniuemgyrmnmkucjnakduqoutzeuxmnfrsbgthxxsgbfltphaqcicuegnqmoojejnzixmrqmfvbeqhtizvtezxdhhihzcbrlbskzesnngzzexlifajbtjzbjzegjdrlarfaqobkvwawvqxluiqntanytmmfydoakfuwtlevscidecypckfynaodaklhreyjqldweuxfaurmkduaonjskuzujixjocshhyqotfkzzuvfkuithvwkirrbmksuidjczcsgvknpatnkthdwbgtpjhbzqiiuhpsbbppglbsysoybokqdrtwcrkbdnmtrkhbsbjnznvpaluniwviqjjvkeajlacakhvxxnbkcpczsoxdvzwzmhiiipxymvqdrnrjzdghgvolchwytxlloqpofoqharwpdmxwlgwbxhphnfgydgzollahtdaaezguctkwqhhhkghixzjnxhmjwkjxovqdctujkoilraobjupgrfpuvjyirhrtauuggqjmiuldlqzfvnlzwmujzglqmmtezzthkgwckbqcjtckqvnucbdgtxkjxdkeaoeiaabvpxpbfbshorujcydlnntnytjdvjfifkqcdonymempmaoigtoxaoxgyfyayajekvmkqqcjznkqufbzyqjujfnactobxelxoekpwhooodbqgwnrzsgfcmrwfaicifrdxajhicjmwcspyjqwhnfphmerelllbgnklroharudgebepynvjpslqurbvnvziesgdqkgtaafklcckaahynpmvepvgvffsexryybmwxrofzbunybzgpvjkvdjfuahcpghtjwrcqqqtzgjipoqbeunobdhdwoyooptpvduvclrqotxpwuqmtnyrhbqqnydusckzuhsxwjmdedujtfpahycknmltbxctpcqzqxwakzwymdjvuswbndrigyekhkaisfrlcoyslahpliqagligsveonsgdtfxtxvicphkqefoyqeucoajqrovugpwtspsieetfhzaaidnygjguwnuictmpgkgkhqlyafvfltwdhuecblbszevjlqgnyanmjfulamgvjlyrgiacvoajbpzbthypddsomlhoyuklkzsjqmvyyymyjjzjlwxzweupbvxyzgwqivyklskojgxobfgokjhulwbuyjaaznajlaazsgvgsqffekzclmiawmoynumfovbigvxdguefctyfdbsvfifmptfkfkzwnksahbptaviwipawlwfzrsjgbbqrwsa2305 Interesting News
- The Odysseus Lander Is Tipped Over on Its Side on the Moon
- Politics
- Mike Sadler guided the first SAS raiders through the North African desert
- 'It's the new normal': in Kyiv's newest book store, readers fear how Ukraine's story will end
- Why Do We Have a Leap Year Anyway?
- They say you can't go home again. Nikki Haley can but it doesn't guarantee votes
- A major earthquake in Japan highlights the country's resilience
- Knorr-Bremse Jumps on Profit Beat, Outlook Upgrade
- Tech Job Interviews Are Out of Control
- 8 Best Deals: Streaming Devices, Smart TVs, and Projectors
- Europe, a laggard in AI, seizes the lead in its regulation
- Google's AI Boss Says Scale Only Gets You So Far
- Australian houses are less affordable than they have been in decades
- This week's covers
- Henry Kissinger and Eric Schmidt take on AI
- Meet the world's new arms dealers
- How a ceasefire vote led to two days of chaos in the Commons – podcast
- ABBA return—and pretend no time has passed—with "Voyage"
- The world should study China's crushing of Hong Kong's freedoms
- Trump soundly defeats Nikki Haley in South Carolina Republican primary
- Going on a Financial Diet? Try One of These Savings Challenges - CNET
- Film-makers are finding horror, not comfort, in the natural world
- Suitors are wooing Paramount
- India's government is forcing X to censor accounts via executive order amid the farmers' protest
- Kara Swisher Is Sick of Tech People, So She Wrote a Book About Them
- As German industry declines, the Ruhr gives hope
- Senegal's judges stand up for the constitution
- How pop culture went multipolar
- Carbon-dioxide removal needs more attention
- The 16 Best Movies on Amazon Prime Right Now
- Economic data, commodities and markets
- This week's covers
- 2023 was the hottest year ever
- France v Italy: Six Nations – live
- Poland is trying to restore the rule of law without violating it
- Severe drought is constraining the Panama Canal
- Why is Italy's public-debt burden so big?
- KAL's cartoon
- Olivia Colman and Jessie Buckley: 'Never repress a woman – because it will come out'
- The fightback against Javier Milei's radical reforms has begun
- Economic data, commodities and markets
- Inside the youth anti-abortion movement in the US: 'Victory is on its way' – video
- Scientists have trained an AI through the eyes of a baby
- FX's Grotesquerie Gives Ryan Murphy a New Horror Canvas
- Many Austrians feel their way of life is under threat
- How to sneak billions of dollars out of China
- Mexico could elect its first female president next year
- AI could help unearth a trove of lost classical texts
- Covid-19 has imperilled the hammams of north Africa and the Levant
- Imran Khan is convicted. Pakistan's generals are content
- The Pro-life Movement's Not-So-Secret Plan for Trump
- Media companies club together for a joint sport-streamer
- Jesus of the Small Screen
- KAL's cartoon
- Zvi Zamir oversaw a programme of Israeli assassinations
- 'I became myself again': makeup guru Bobbi Brown on a lifetime perfecting the natural look
- Chile is still haunted by the coup in September 1973
- What survey data reveal about antisemitism in America
- Taiwanese politics faces a crucial election in early 2024
- Australia and China patch things up
- Canada's assisted dying laws in spotlight as expansion paused again
- Virtual Staging AI helps Realtors digitally furnish rooms within seconds
- What Javier Milei could learn from Peru's economic successes
- 17 Tips to Take Your ChatGPT Prompts to the Next Level
- New Jersey introduced a smart voting reform—then let it lapse
- China's economy is suffering from long covid
- Does Hamas want to keep fighting Israel or start talking peace?
- Guatemala's elite may try to scupper the presidential election
- The Complete History And Future of Robots
- Duke's Kyle Filipowski hurt by fan after Wake Forest's court-storming upset
- Antidepressant use is surging in Britain
- Why skipping ropes are so expensive in China
- A net-zero world needs new markets and institutions
- This is not a story about Taylor Swift and the Super Bowl
- This Tiny Website Is Google's First Line of Defense in the Patent Wars
- How China stifles dissent without a KGB or Stasi of its own
- Donald Triplett was autism's "Case 1"
- It's More Than a Phone Case. For Gen Z, It's a Status Symbol.
- Places ravaged by opioids are giving Republicans the upper hand
- Charlie Peters, the man who tried to save Washington
- Give Us an Xbox Handheld Already
- Green-lit or greenlighted? Gaslighted or gaslit?
- The pandemic has accelerated a global decline in the rule of law
- Will Chad be the next Western ally in Africa to fall?
- An inspiring, if frustrating, portrayal of the Williams sisters' coach and dad
- Colm Toibin's new novel brings Thomas Mann to life
- Can Argentina's next president fix the economy? Don't count on it
- Elon Musk's Battle with Swedish Unions Is Now Impacting Tesla's Charging Stations
- Economic data, commodities and markets
- Wolves v Sheffield United: Premier League – live
- Mimi Reinhard typed up Schindler's list
- The ICJ delivers a stinging rebuke to Israel over the war in Gaza
- Economic data, commodities and markets
- Yurii Kerpatenko refused to bow to Russian orders
- Carl Bernstein's memoir traces his path to Watergate
- Older British voters still favour the Tories. Others, not so much
- Vivian Silver knew no good could ever come of war
- Three climate fights will dominate COP28
- Business
- SpaceX May Be Withholding Satellite Internet in Taiwan, Congressman Contends
- German farmers and train drivers are scaring the country's bosses
- AI Is in the Midst of a Fever Dream and It's Only Getting Worse
- Javier Milei implements shock therapy in Argentina
- After 2 years of war in Ukraine, 6 cities hold out hope under fire
- Welcome to the ad-free internet
- These are the most expensive cities in North America
- The age of the unicorn is over
- Bluesky's Future Is Social Media's Past
- Satellite Images Point to Indiscriminate Israeli Attacks on Gaza's Health Care Facilities
- Trump v Biden: who's ahead in the polls?
- Google's 'Woke' Image Generator Shows the Limitations of AI
- Politics
- KAL's cartoon
- How oceans became new technological battlefields
- The taboos around sexual health are weakening
- In South Carolina, Nikki Haley's Bill Comes Due
- Complexities of moderating and classifying video games
- Is Ukraine losing the war against Russia?
- Which economy did best in 2023?
- Sticking together makes bacteria nearly invincible
- Glenda Jackson left acting for politics—and then returned
- Mikhail Gorbachev did not mean the Soviet Union to end that way
- Could AMD break Nvidia's chokehold on chips?
- Saotome Katsumoto insisted that Japan should not forget
- KAL's cartoon
- The Ukraine war offers energy arbitrage opportunities
- The WIRED Guide to Aliens
- AT&T Mobile Service Outage Cuts Off Thousands Nationwide
- You Spend Hours a Day in Your Browser. Now Make It Better.
- 'They stuck two fingers up to Fifa': the Lost Lionesses and the forgotten 1971 women's World Cup
- 'Over Time the Trust Will Come': An Exclusive Interview With TikTok's CEO
- KAL's cartoon
- How China sees Gaza
- The 256GB iPad mini is $120 off and down to a record-low price
- 2023 looks set to be a watershed year for the climate
- The rise and rise of e-sports
- Black workers are enjoying a jobs boom in America
- Don't be fooled by America's "new" supply chains
- This week's cover
- Shyam Saran Negi never failed in his democratic duty
- The battle of northern Gaza is almost over
- Economic data, commodities and markets
- Narendra Modi and the art of claiming credit
- Immigration, Ukraine distrust and January 6 games: Republican agenda on display at CPAC
- Donald Trump's legal fees are draining his campaign funds
- Andrés Manuel López Obrador has reduced poverty in Mexico
- Framework's new sub-$500 modular laptop has no RAM, storage or OS
- Southern Gaza could become more densely populated than Delhi
- Universities are failing to boost economic growth
- Big tech and geopolitics are reshaping the internet's plumbing
- Economic data, commodities and markets
- Economic data, commodities and markets
- Economic data, commodities and markets
- Reddit Is Letting Power Users In on Its IPO. Not Everyone's Buying
- Our tracker of voters' intentions shows the contest behind Trump
- Rumours swirl after China's defence minister, Li Shangfu, is sacked
- Sierra Says Conversational AI Will Kill Apps and Websites
- The age of the grandparent has arrived
- New industrial policies will make the world more unequal
- Britain's chancellor offers tax cuts and fiscal trickery
- Could the war in Ukraine go nuclear?
- This week's cover
- Xi Jinping bumps up the share prices of firms he visits
- Why the market for superyachts is booming
- China may be losing its sway over Taiwanese business
- This week's covers
- The Gaza war has deepened Joe Biden's Iran nightmare
- Kentucky eyes ibogaine, a psychedelic, to treat opioid addiction
- Why those who wish to see Trump jailed soon will be disappointed
- Russian spies are back—and more dangerous than ever
- Which countries get the best night's sleep?
- 2054, Part VI: Standoff at Arlington
- Joe Biden puts the Houthis back on America's baddies list
- Vladimir Putin has been fighting not just Ukraine, but his own people
- Meta Staff Found Instagram Tool Enabled Child Exploitation. The Company Pressed Ahead Anyway.
- Leading Lab-Grown Meat Company Upside Foods Just Paused a Major Expansion
- Jokowi is building a political dynasty
- NASA's PACE satellite will tackle the largest uncertainty in climate science
- Did UN workers participate in the October 7th attacks?
- Is the world's most important asset market broken?
- Economic data, commodities and markets
- She Confessed to Killing Amish Children in a Crash. Then the Mystery Began.
- Europe's monarchies are a study in dignified inanity
- A Tokyo district cracks down on Halloween
- China has embraced pets, but animal welfare is still a problem
- Nvidia Declares AI a 'Whole New Industry'---and Investors Agree
- Help, My Friend Got Me a Dumb AI-Generated Present
- Economic data, commodities and markets
- Ukrainian stand-up comedy has seen a renaissance during the war
- KAL's cartoon
- Like human armies, army ants trail crowds of hangers-on
- Why are there so many suicides in rich, stable Uruguay?
- Hsiao Bi-khim is Taiwan's cat warrior
- Microsoft's upcoming custom chip will be made by Intel
- Economic data, commodities and markets
- Sunak stands with net zero and climate conspiracy group at farming protest
- Economic data, commodities and markets
- Millions of Chinese have embraced skiing
- Apple's Latest iOS 17.4 Tool Boosts Battery Insights for the iPhone 15 - CNET
- WIRED's Biggest Interviews of 2023
- To help schoolchildren in poor countries, reduce lead poisoning
- Riot's Project L fighting game is officially titled 2XKO
- Google Tests Killing the News
- What will artificial intelligence mean for your pay?
- American consumers are finally cheering up
- A trove of photographs casts light on Bangladesh's liberation war
- Europe finds €50bn for Ukraine, and a way around Viktor Orban
- Eric Freeman hoped to save the Gloucestershire of old
- How a tide of tech money is transforming charity
- Watching "The Shawshank Redemption" on stage in China
- Navgix - A Multi-Threaded Golang Tool That Will Check For Nginx Alias Traversal Vulnerabilities
- India's businessmen like Narendra Modi. They also fear him
- Jovenel Moïse's widow is accused of being party to his murder
- Economic data, commodities and markets
- This week's covers
- Deaths in Gaza surpass 14,000, according to its authorities
- Israel scorns America's unprecedented peace plan
- How to Close the 'Orgasm Gap' for Heterosexual Couples
- The ethical quagmire of a fetus-harming epilepsy drug
- The world this year 2023
- Scientists want to fix tooth decay with stem cells
- India is seeing a massive aviation boom
- Why Nimona Got Saved From Disney to Become an Oscar Contender
- Gone in 20 seconds: how 'smart keys' have fuelled a new wave of car crime
- 'They didn't understand us at all': why the miners' strike still captivates Britain, 40 years on
- How an English miner's daughter rose to work in the White House
- Loretta Lynn gave all struggling women a voice
- Why economists are at war over inequality
- KAL's cartoon
- Madeleine Albright saw herself as an ambassador for freedom
- China approves the world's first flying taxi
- A palatial museum of Edvard Munch's art opens in Oslo
- Beefing up Poland's armed forces
- At last, a convincing explanation for America's drug-death crisis
- Ancient, damaged Roman scrolls have been deciphered using AI
- EV Startups Struggled to Build Cars. Now They Struggle to Sell Them.
- For a second time Chileans reject a new constitution. Now what?
- Israel has just a few weeks left to destroy Hamas
- Israel's judge in The Hague is its government's bogeyman
- Chinese feminists are rebuilding their movement abroad
- Colombia's first avowedly left-wing president is mired in scandal
- American universities face a reckoning over antisemitism
- Investors are going loco for CoCos
- Bangladesh strikes a blow against lead poisoning
- The Skilled Workers Training AI to Take Their Jobs
- Economic data, commodities and markets
- Why not impeach everyone?
- Meta's Oversight Board will now hear appeals from Threads users, too
- Economic data, commodities and markets
- After Nayib Bukele's crushing, unconstitutional victory, what next?
- Will a fiscal mess thwart Japan's nascent economic growth?
- The best Apple Watch in 2024
- Meta is testing cross-posts from Facebook to Threads
- Human diets are becoming less diverse, a new book warns
- Peter Brook saw acting as an uncompromising search for truth
- Germany strikes a brave new deal on immigration
- Swimming's ruling on transgender women continues a trend
- Benjamin Zephaniah stayed angry all his life
- The Notorious Lockbit Ransomware Gang Has Been Disrupted by Law Enforcement
- WEB-Wordlist-Generator - Creates Related Wordlists After Scanning Your Web Applications
- Carbon-dioxide-removal options are multiplying
- New OpenAI Technology Can Create Realistic Video From a Line of Text
- Why America's controls on sales of AI tech to China are so leaky
- The world continues to garble the name and title of Xi Jinping
- A tiny right-wing party tries to menace Britain's Conservatives
- The Meteoric Rise of Nvidia, in Five Charts
- Roman Ratushny believed in a better, purer Ukraine
- Ko Jimmy was determined to make Myanmar free
- 'Does rewilding sort climate change? Yes!': UK expert says nature can save planet and not harm farming
- Donald Trump is the conservative media
- How Boris Pistorius is transforming the German armed forces
- The world's first pathway for individually designed drugs
- The National Health Service has a new drugs deal
- Bad Bunny, a superstar rapper, is good business
- Bowel cancer is rising among young people
- Germany's new party on the far left may eat into the far right
- Is democracy dying in Africa? Senegal's slide into chaos bodes ill in a year of key elections
- Javier Milei will be Argentina's first libertarian president
- Measles Strikes a Florida Elementary School With Over 100 Unvaccinated Kids
- Do rising methane levels herald a climate feedback loop?
- Alzheimer's disease may, rarely, be transmitted by medical treatment
- The notable obituaries of 2023
- Tracking ships in the Red Sea
- The Italian cricket-breeders putting a positive spin on insect-based food
- How Stress Could Make Cancer Spread
- The Life and Gruesome Death of a Bog Man Revealed after 5,000 Years
- Kenya is belatedly granting citizenship to groups once deemed foreign
- Economic data, commodities and markets
- Melee - Tool To Detect Infections In MySQL Instances
- North Korea is getting new ships
- Geert Wilders makes a show of respecting the law
- America's bad auto loans could have nasty consequences
- Xi Jinping builds a 21st-century police state
- Chile's crisis is not over yet
- PlayStation now supports passkey sign-ins
- Who will be the next president of Indonesia?
- Charter schools do things that all Democrats say they support
- Snag These Last-Minue Deals From Best Buy's Member-Exclusive Sale Before It Ends Today - CNET
- Giorgia Meloni has proved the doubters wrong
- All That Rain Is Driving Up Cases of a Deadly Fungal Disease in California
- Everything We Know About the Google Pixel 9
- Britain's armed forces are stretched perilously thin
- NATO is agonising over whether to let Ukraine join
- Metal Prices Are Soaring. So Is Metal Theft
- AzSubEnum - Azure Service Subdomain Enumeration
- Vladimir Putin wants to catch up with the West in AI
- Productivity has grown faster in western Europe than in America
- AI Mania Lifts Stock Indexes to Records
- Economic data, commodities and markets
- Netflix Kills Movie Plans for Percy Jackson Spinoff Kane Chronicles
- African governments return to international bond markets
- 'Spec Ops: The Line' Disappeared. It Won't Be the Last Beloved Game to Vanish
- Britain's least valuable coin is in terminal decline
- Apple Pulls Popular Movie Piracy App Kimi From the App Store
- Natural Gas Hasn't Been This Cheap in Decades
- Autonomous vehicles are coming, but slowly
- A controversial general is likely to be Indonesia's next leader
- How worried should Amazon be about Shein and Temu?
- SqliSniper - Advanced Time-based Blind SQL Injection Fuzzer For HTTP Headers
- Italy's new government needs to make deep economic reforms
- Europe's technology startups are doing just fine
- TikTok is a key battleground in Indonesia's election
- Intuitive Machines' Odysseus lander tipped over at touchdown, but it's still kicking
- America may soon be spending more on debt service than defence
- WPP Profits Hurt by Impairments
- The controversy over Britain's planned Holocaust memorial
- Ian Hamilton masterminded one of the most daring heists of the last century
- Ukrainian Factory: two years of war for a Mykolaiv key worker
- Recep Tayyip Erdogan's relatives are becoming increasingly powerful
- Here Are the Secret Locations of ShotSpotter Gunfire Sensors
- What happened to the artificial-intelligence investment boom?
- Economic data, commodities and markets
- Reassessing Obama's biggest mistake
- 15 Best Fitness Trackers (2024): Watches, Bands, and Rings
- The president appoints modern France's youngest prime minister
- Do abortion-related benefits help American firms recruit?
- A lawsuit in New York may shake things up at the NRA
- Finn Russell weaves more magic for Scotland to raise roof at Murrayfield | Gerard Meagher
- Florida too may have an abortion referendum in November
- Jeremy Hunt wants to improve Britain's public-sector productivity
- Lloyds Banking To Start Buyback After Profit Beat
- Google Restricts AI Images Amid Outcry Over Chatbot's Treatment of Race
- When High-Yield Savings Accounts Come With an Asterisk
- Mexico's foreign policy is unambitious and erratic
- BounceBack - Stealth Redirector For Your Red Team Operation Security
- UK parliament descends into chaos over Gaza ceasefire vote – video report
- Wagner routinely targets civilians in Africa
- Violence spirals as Iran's proxies kill American soldiers
- Why it might be time to buy banks
- Is it cheaper to rent or buy property?
- A court rejects Donald Trump's claim to absolute immunity
- The BRICS bloc is riven with tensions
- Arturia adds an 88-key option to its KeyLab Essential mk3 line of MIDI controllers
- China's population is shrinking and its economy is losing ground
- Introducing The US in brief, our new daily political newsletter
- Russia's friends are a motley—and shrinking—crew
- Is working from home about to spark a financial crisis?
- Economic data, commodities and markets
- The false promise of friendshoring
- Two new books assess the geopolitical lessons of covid-19
- What does China want from Latin America and the Caribbean?
- The EU's covid-19 recovery fund has worked, but not as intended
- American pollsters aren't sure they have fixed the flaws of 2020
- Where are Europe's most expensive cities for renters?
- Turkey's economy has improved, but its foreign policy is still messy
- The countries which raised rates first are now cutting them
- Rowdy Flock: a daughter, her dreams, and a sheep farm in Norway
- Reddit files for IPO and will let some longtime users buy shares
- Henry Kissinger, a statesman beyond reproach, in China at least
- A new therapy for Ukraine's scarred soldiers: ketamine
- A new gonorrhoea drug was developed by a non-profit foundation
- This week's covers
- What Would Happen if Every American Got a Heat Pump
- Where will the next coup be in Africa?
- Will North Korea's new spy satellite make the region safer?
- Where does the modern state come from?
- NullSection - An Anti-Reversing Tool That Applies A Technique That Overwrites The Section Header With Nullbytes
- Surging Nvidia Stock Keeps Drawing In More Believers
- Trenches and tech on Ukraine's southern front
- Western values are steadily diverging from the rest of the world's
- Congo's M23 rebellion risks sparking a regional war
- This week's cover
- The Score: Discover Financial Services, Nvidia, AT&T and More Stocks That Defined the Week
- Can a Tech Giant Be Woke?
- Biden Caught in a Political Bind Over Israel Policy
- Lester Piggott had only one aim in view
- 'Their happiness is imprinted upon my mind': Kyaw Zay Yar Lin's best phone picture
- As payments systems go digital, they are changing global finance
- Business
- How Not to Be Stupid About AI, With Yann LeCun
- Can Sino-Arabian business ties replace Sino-American ones?
- Economic data, commodities and markets
- Is Hizbullah stepping back from the brink of war?
- Democracy is under attack in Senegal
- A startup called Anduril has unveiled a reusable missile
- The Hidden Injustice of Cyberattacks
- Charlie Munger was a lot more than Warren Buffett's sidekick
- China's push to create a single national identity
- Sncscan - Tool For Analyzing SAP Secure Network Communications (SNC)
- The New York Public Library mines its archive of 56m objects
- The latest in the battle of jamming with electronic beams
- Why rail electrification is so slow in Britain
- How Tribeca Pediatrics Became a Vast Business Empire
- Could digital-payments systems help unseat the dollar?
- Airborne taxi ranks are coming to a sky near you
- China wants women to stay home and bear children
- The four women who shook up philosophy
- China wants to be the leader of the global south
- Many CEOs fear a second Trump term would be worse than the first
- Politics
- Britain wants to make nuclear power plants cheaper to build
- Argus - A Framework for Staged Static Taint Analysis of GitHub Workflows and Actions
- A war correspondent's intimate portrait of an embattled minority
- How cheap drones are transforming warfare in Ukraine
- Politics
- The deadly missile race in the Middle East
- This week's covers
- SploitScan - A Sophisticated Cybersecurity Utility Designed To Provide Detailed Information On Vulnerabilities And Associated Proof-Of-Concept (PoC) Exploits
- The best podcasts of 2021
- Why Chinese mourn Li Keqiang, their former prime minister
- Mexico's 'Hugs, Not Bullets' Crime Policy Spreads Grief, Murder and Extortion
- Venezuela's Supreme Court tests President Joe Biden
- China's Stock-Sale Ban Eases Path to Propping Up Reeling Markets
- Trump wants to whack Chinese firms. How badly could he hurt them?
- How a sombre mood gripped Europe
- Everything about carmaking is changing at once
- Israel has yet to destroy even half of Gaza's tunnels
- First Amendment Fight Pits Red States Against Big Tech at Supreme Court
- Fernando Botero became famous for his over-size people and animals
- Final Fantasy 7 Rebirth review: A whole new world
- Your Barbie Dream Phone Is About to Become a Reality - CNET
- Issey Miyake saw clothes in a completely new way
- Two new books shed light on the plight of the Uyghurs
- Why sweet treats are increasingly expensive
- KAL's cartoon
- Scientists develop 'nanosphere' paint that could reduce planes' carbon dioxide emissions
- Intel's CEO Says AI Is the Key to the Company's Comeback
- Plants don't have ears. But they can still detect sound
- Where's My 2024 Tax Refund? How to Check the Status - CNET
- Should rich countries pay for climate damage in poor ones?
- AI can transform education for the better
- Vera Putina claimed to be Vladimir Putin's real mother
- Nostalgia for China's boom years drives a TV hit
- Is Harvard Business School too woke?
- Super League should take more pride in itself, insists Wigan Warriors' Matt Peet
- The (sort of) isolationist case for backing Ukraine
- Taiwan's opposition parties are struggling to unite
- Geert Wilders struggles towards power in the Netherlands
- Donald Trump's tremendous love
- Virtual Bar Scenes Are a New Tool to Study Why People Commit Crimes in the Heat of the Moment
- An old health insurance scheme in China may have saved millions
- Ukraine's Shock Will Last for Generations
- An advocate of sustainable capitalism explains how it's done
- Can computing clean up its act?
- Economic data, commodities and markets
- Russia's War on Ukraine Chills Arctic Climate Science
- 'My ultimate and absolute revenge': Trump gives chilling CPAC speech on presidential agenda
- A New Year's interview with Volodymyr Zelensky
- How to Not Get Scammed Out of $50,000
- Donald Trump Wins South Carolina Republican Primary
- Economic data, commodities and markets
- Politics
- Ethiopia's prime minister wants a Red Sea harbour
- America and Iran step closer to the brink of war
- Singapore cracks down on Chinese influence
- Armenia is turning against its erstwhile guardian, Russia
- The world's least liveable cities are starting to improve
- Is running a top university America's hardest job?
- Shark Teeth Are Time Machines
- Taiwan's dominance of the chip industry makes it more important
- How American journalism lets down readers and voters
- African leaders want debt relief for climate action
- Latin America could become this century's commodity superpower
- An unusual museum in China is dedicated to Vinegar Joe
- Mexico's gangs could be the country's fifth-biggest employer
- Sir Paul McCartney's memoir aims to affirm his status as a writer
- Daniel Ellsberg leaked the Pentagon Papers to try to stop the Vietnam war
- You Know It's a Placebo. So Why Does It Still Work?
- Dune: Part Two: Who's Who and What You Need to Remember
- America's political paralysis is complicating its support for Ukraine
- Is Ukraine's counter-offensive over?
- These are the world's most expensive cities
- Some good news about America's fertility problem
- Despite its sympathies, Egypt is unlikely to help Palestinian refugees
- The Americans Who Need Chaos
- What if China and India became friends?
- Taiwan is a vital island that is under serious threat
- Chrome's latest experimental AI feature can help you write
- New rules for America's green-hydrogen industry are controversial
- Why Monday is the most misunderstood day
- How to benefit from the conversations you have at work
- Is Argentina's new president too divisive to fix a broken economy?
- Art shows the surreal reality of wartime Ukraine in a way the news never could | Charlotte Higgins
- Google explains why Gemini's image generation feature overcorrected for diversity
- Economic data, commodities and markets
- Economic data, commodities and markets
- How to house the world's fastest-growing population
- Anonymous tipsters, angry at Russia, help detect sanctions-busters
- Wines That Entertain as Well as Impress
- Economic data, commodities and markets
- Pope Benedict XVI was an iron fist in a white glove
- Business
- How plundered Gaulish silver ended up in Roman coins
- A new way to predict ship-killing rogue waves
- Israel is pushing into southern Gaza as the clock ticks down
- Google's AI Boss Says Scale Only Gets You So Far
- Phyllida Barlow had a lifetime of adventure making art
- Trump Tightens Hold on GOP, Crowding Out Even Popular Rivals
- Business
- 'Deadpool & Wolverine' Trailer Hopes Pegging Can Save the MCU
- More Americans than ever report a disability
- Foreign students are pouring back into Australia
- America suspends duty-free access to four African countries
- Musk v Zuckerberg: who's winning?
- Did spies from China, India and Russia meddle in Canada's elections?
- The speech police are coming for social media
- Some German Jews say their country goes too far defending Israel
- Are You Bleeding Money on Car Insurance? So Are Insurers
- Reddit Warns That r/WallStreetBets Could Wreak Havoc on Its Stock Price
- The 2023 Nobel prizes honour work that touched millions of lives
- Economic data, commodities and markets
- Heart attacks, strokes, dementia—can Biden and Trump beat the odds?
- America's missing doctors
- Could Neanderthals Make Art?
- No, Google Isn't Sunsetting Gmail
- Flitescooter eFoil First Ride: This $13K Hydrofoil Meant for Amateurs Is a Rough Ride
- A museum in Rotterdam opens up its collection
- Telefonica Earnings Top Forecasts
- From Gaza to Ukraine, wars and crises are piling up
- The row over US Steel shows the new meaning of national security
- French fighter jets join the Baltic mission
- This week's cover
- How Yemen's dominant Houthis blackmail foreign aid agencies
- Trump's lead over Biden may be smaller than it looks
- Fairness: the hidden currency of the workplace
- What Britain's Labour Party thinks of Europe
- Israel's ground assault hits Gaza's communication network
- Can run-down Blackpool turn itself around?
- Why BlackRock is betting billions on infrastructure
- The election in Georgia could be as pivotal as it was four years ago
- Hydrogen Car Owners Are Still Waiting For the Future to Arrive
- Can Europe arm Ukraine—or even itself?
- If Israel invades, hell looms in Rafah
- A nationalist effort to rebrand the Chinese dragon
- Brexit finally becomes real for imports of EU goods into Britain
- Oe Kenzaburo was made a writer by a family crisis
- Wales wants to be more like Scandinavia
- The former prime minister who fascinates the Labour Party
- Economic data, commodities and markets
- Superbatteries will transform the performance of EVs
- Economic data, commodities and markets
- Can Lula fix Brazil's fiscal mess?
- Labour wants to make Brexit work better. What does the EU think?
- Equity Shot: All about the Reddit IPO!
- Economic data, commodities and markets
- China is backing opposing sides in Myanmar's civil war
- The Dark Hedges are dying
- Will lab-grown meat ever make it onto supermarket shelves?
- Pema Tseden was the founder and builder of Tibetan cinema
- The five biggest market surprises of 2023
- An election that could make the global internet safer for autocrats
- The best gaming laptops for 2024
- Like cigarettes, junk food should come with a warning: 'Can kill' | Martha Gill
- India's Supreme Court delivers a rare setback for Narendra Modi
- Governments across the world are discovering "homeland economics"
- Environments can affect language—just not how you think
- Help, My Friend Got Me a Dumb AI-Generated Present
- SADProtocol goes to Hollywood
- Mercedes-Benz Warns on Outlook as Market Uncertainty Weighs
- Economic data, commodities and markets
- Play outside and sing together: what living in Denmark taught me about raising 'Viking' children
- Israel's current large-scale operation is the last one in Gaza
- Guatemala's election produces a pleasant surprise
- Eight charts illustrate 2023's extreme weather
- Xiaomi Redmi Note 13 Pro+ Review: Attractive and Affordable
- Europe's economy is in a bad way. Policymakers need to react
- The Middle East crisis is splitting the French opposition
- A chunk of asteroid is coming to Earth
- TikTok Faces EU Investigation Over Protection of Minors, Harmful Content
- Xi Jinping's paranoia is making China isolated and insular
- Florida's Experiment With Measles
- The Caribbean is awash with illegal American guns
- Riker's Hometown Wants to Put a Perfectly Postured Statue Up in His Name
- A Buff Bill Skarsgård Seeks Wacky Post-Apocalyptic Revenge in Boy Kills World
- Inside OpenAI's weird governance structure
- Spain's prime minister secures his job, at a high cost
- A short history of Hollywood's poison-pen letters to itself
- 2054, Part III: The Singularity
- As Israel fights on in Gaza its dilemma gets worse
- The people of Hong Kong are growing more tolerant
- Israel's offensive against Hamas enters its crucial stage
- Video games, power and diplomacy
- A new English version of "The Arabian Nights" is the first by a woman
- The super-rich are trying new approaches to philanthropy
- In Europe, green policies rule while green politicians struggle
- Economic data, commodities and markets
- What Is Christian Nationalism, Exactly?
- A thumping win for Tshisekedi in Congo's election raises eyebrows
- Gao Yaojie uncovered a scandal that shocked and shamed China
- South Korea's ban on praising the North is ridiculous
- Narendra Modi has shifted India from the Palestinians to Israel
- Places claiming to be centenarian hotspots may just have bad data
- Is an uprising by Europe's farmers sowing the seeds for the far right? – podcast
- A '90s Classic, Remade
- Taiwan needs a new defence strategy to deal with China
- Tech Still Isn't Doing Enough to Care for the Environment
- Muhammad Amir Muhammad Khan fought India's government for five decades
- 2054, Part VI: Standoff at Arlington
- Why is Brazil a hotspot for financial crime?
- Jessamine Chan's gripping debut novel sends up modern parenting
- Japan is a cuddlier friend to South-East Asia than America or China
- This week's covers
- A Backroom Deal Looms Over Section 702 Surveillance Fight
- Rolls-Royce goes electric—in style
- SpeedyTest - Command-Line Tool For Measuring Internet Speed
- Economic data, commodities and markets
- Homeland Economics
- Axa Lifts Dividend, Launches Buyback
- Trump scores big win in South Carolina Republican primary
- Ibrahim Mahama and the art of resurrection
- A new book shows how the Greek revolution shaped Europe
- Death, debts and democratic doubts in Africa
- The "Scream" franchise adds another self-referential sequel
- Politics
- Flimsy Antiabortion Studies Cited in Case to Ban Mifepristone Are Retracted
- Bitcoin ETFs are off to a bad start. Will things improve?
- The Supreme Court may toss out Purdue Pharma's bankruptcy settlement
- Sweden is suffering a grim wave of gang violence
- How to succeed—and fail—as a foreign business in India
- South-East Asia learns how to deal with China
- Tell us: share your experience of working out as a family
- SpaceX Forges Closer Ties With U.S. Spy and Military Agencies
- For the perfect cup of tea, start with the right bacteria
- Throughout the rich world, the young are falling out of love with cars
- A new play stages excerpts from the Grenfell Tower fire inquiry
- Taiwan election poll tracker: who will be the next president?
- Abir Mukherjee adds a twist to his winning crime formula
- The decline and fall of Harvard's president
- Self-Driving Cars: The Complete Guide
- The US Supreme Court is primed to recalibrate government power
- Ronald Blythe recorded the passing, and continuance, of rural life
- JWST Is Tracking Down the Cosmic Origins of Earth's Water
- This Treasured Fossil Turns Out to Be a Forgery
- France uncovers a vast Russian disinformation campaign in Europe
- Forget Carbon Offsets. The Planet Needs Carbon Removal Credits
- China's government launches a campaign against medical corruption
- How the spirit of Jacques Delors might be rekindled
- N.Y.'s crusading attorney general wins again with NRA verdict, Trump judgment
- Nvidia CEO Jensen Huang Is Powering the AI Revolution
- The World's Most Important Industry Has a New Captain—and She's Piloting It Into the 21st Century
- KAL's cartoon
- India tightens the screws on online dissent
- This week's cover
- Russians have emigrated in huge numbers since the war in Ukraine
- What kind of legacy does Rishi Sunak want to leave behind?
- American life-sciences firms are moving labs downtown
- 17 Tips to Take Your ChatGPT Prompts to the Next Level
- Iran is targeting its opponents in Britain
- The Danger Lurking Just Below Ukraine's Surface
- SunRay Kelley wanted to build in rhythm with nature, his teacher
- Brexit was wrong, say 57% of British voters
- Two ideas of free speech duel at America's Supreme Court
- Teachers in Indiana: share your views on the Eyes on Education site
- Economic data, commodities and markets
- The agony of 24 hostages is over. The Gaza war isn't
- How geopolitical tensions could disrupt the global car industry
- Politics
- A posthumous novel from John le Carré
- Xi Jinping is obsessed with political loyalty in the PLA
- Israeli soldiers fight to reach Hamas's headquarters
- Suella Braverman uses a pro-Palestinian march to sow discord
- China's quest to become a robot superpower
- Africa's supermarket revolution
- The pandemic's indirect effects on small children could last a lifetime
- Britain is failing citizens who are unlawfully detained overseas
- Xi Jinping risks setting off another trade war
- A New Startup Wants to Turn the Sugar You Eat Into Fiber
- Will China save the planet or destroy it?
- Economic data, commodities and markets
- "Barbie" and "Oppenheimer" show that blockbusters could save the cinema
- Stellantis CEO says there's still life in Waymo deal for self-driving delivery vans
- Prabowo Subianto will be Indonesia's next president
- Can rich countries care for the old without going bust?
- Isabel Crook devoted her long life to making a new China
- Economic data, commodities and markets
- Two new books explore the impact of accelerating technology
- Could the Israel-Hamas war trigger unrest across the Arab world?
- China's stockmarket nightmare is nowhere near over
- South Korean chipmakers get a reprieve
- Israel prepares for a long war in Gaza
- Stunning Comet Could Photobomb This April's Total Solar Eclipse
- India's opposition bloc disintegrates
- India-Pakistan relations are becoming more marginal and worse
- Britain's council tax is arbitrary, regressive and needs fixing
- Alex Garland's New Civil War Trailer Is Still Freaking Us Out
- How the Iraq war bent America's army out of shape
- Joe Biden's limits on LNG exports won't help the climate
- Amid turmoil in China's property market, the public seethes
- Europe is struggling to find the money
- Shifting to EVs Could Prevent Millions of Childhood Asthma Attacks
- Can the Palestinian Authority be beefed up?
- Simine Vazire hopes to fix psychology's credibility crisis
- To save the Amazon, Lula must work out who owns it
- Korean Stocks Have a New Driver: The Government
- Is China a winner from the Red Sea attacks?
- In 2021 our writers considered technology, meritocracy and the trans debate
- How covid-19 spurred governments to snoop on sewage
- Adolfo Kaminsky saved thousands of Jews by changing their identities
- Scientists have published an atlas of the brain
- The world is bracing for Donald Trump's possible return
- The flaws that China's chief ideologue found in America
- Why Donald Trump is gaining ground with young voters
- How the Gaza war affects Israel's minorities in different ways
- Meta Encourages Advertisers to Ditch iPhone in Latest Spat With Apple
- Europe can't decide how to unplug from China
- Another crypto boss falls
- Republicans are turning against Ukraine
- Xi Jinping repeats imperial China's mistakes
- AI could accelerate scientific fraud as well as progress
- America's southern border has become a global crossroads
- The bold Texas plan to stop migrants has hit a wall
- Is Britain's plan to send asylum-seekers to Rwanda salvageable?
- An expert on civil war issues a warning about America
- The bosses of OpenAI and Microsoft talk to The Economist
- Protests are soaring, as China's workers demand their wages
- This week's cover
- Argentina's Javier Milei begins his radical experiment in libertarian rule
- The sudden demise of Indian vultures killed thousands of people
- A clash over Trump's disqualification tests the Supreme Court
- Politics hampers Delhi's fight against air pollution
- The new economy net zero needs
- Ukraine's new enemy: war fatigue in the West
- Has America really escaped inflation?
- These are the most liveable cities in Europe
- Senegal's democracy hangs by a thread
- Economic data, commodities and markets
- How Hindu is India's foreign policy?
- How an ugly marital feud could change Indian business
- Video: How we studied the lessons of Ukraine
- Inside the Spectocracy
- Britain's economy will need rate cuts sooner rather than later
- Economic data, commodities and markets
- Stable Diffusion 3 is a new AI image generator that won't mess up text in pictures, its makers claim
- How British voters remove misbehaving MPs
- The world is (still) failing to come close to its climate goals
- Latin America is set to become a major oil producer this decade
- Jacqueline Gold freed women to shamelessly enjoy themselves
- After an unsuccessful boycott, women's tennis is back in China
- The consequences of Donald Trump's huge fine for fraud
- The year everything (and nothing) changed in the Middle East
- The biggest obstacle to saving rainforests is lawlessness
- Every country wants its own investment-screening regime
- The Sycamore Gap tree held a particularly deep place in people's hearts
- Reddit's IPO Filing Is Missing Something: Cofounder Alexis Ohanian
- Turkey has given up promoting political Islam abroad
- The Spy War: How the C.I.A. Secretly Helps Ukraine Fight Putin
- Joe Biden and Xi Jinping rediscover the joy of talking. Good
- Business
- Gaza's nights are darker now than at any point in the past decade
- Can scientists save your morning cup of coffee?
- How many books will you read before you die?
- The cost of the global arms race
- Britain tries to correct the treatment of gender-dysphoric kids
- Can Inflatable Outdoor Furniture Ever Be Chic?
- These American cities are obsessed with dogs
- Big oil agrees to slash methane emissions
- Weekend podcast: the Libertines' tortured reunion, Marina Hyde on celebrity-dictator bromances, and the simple trick to enjoying life more
- Abe Shinzo believed that Japan should assert itself in the world
- Why TikTok Is So Obsessed With a Mysteriously Pregnant Stingray
- Who was the best CEO of 2023?
- Donald Trump Pledges to Protect AM Radio in Rambling Speech to Christian Broadcasters
- The search for Conservative Party unity
- Economic data, commodities and markets
- Business
- More »
- The 8Bitdo Ultimate C controller is on sale for $25 today only
- How will America's economy fare in 2024? Don't ask a forecaster
- How Sleep Engineering Could Help Heal the Brain
- Rivian is laying off 10 percent of its salaried employees
- Robert Solow was an intellectual giant
- The promise of crypto has not lived up to its initial excitement
- Henry Kissinger never quite belonged where he wanted to be
- American and Chinese scientists are decoupling, too
- Trump's Sale of D.C. Hotel Proved Prescient as New Owner Defaults on Loan
- Andrés Manuel López Obrador splashes out as elections loom
- China is building nuclear reactors faster than any other country
- Cezanne seascape mural discovered at artist's childhood home
- Why stockpickers should get out more
- This week's covers
- The government tries to unlock growth capital for British firms
- What Makes Russia's Economy So Sanctions-Resistant?
- The Spy Who Dumped the CIA, Went to Therapy, and Now Makes Incredible Television
- Taiwan's elections are about more than China
- Latin American cities are struggling in the liveability ranking
- Donald Trump is ordered to pay for his bullying
- People with Myalgic Encephalomyelitis/Chronic Fatigue Syndrome May Have an "Exhausted" Immune System
- Britain's health-care system looks rather as it did in the 1930s
- Antarctic sea ice is at a record low
- Sources and acknowledgments
- The prospect of a Trump presidency looms over Mexico's elections
- Business
- Jack Jennings was one of the Allied POWs who built the Burma Railway
- Meet the Former CFO Who Thinks He Can Fix Disney
- Heat Pumps Outsell Gas Furnaces Once Again: What's the Difference? - CNET
- How to get rich in the 21st century
- China and Bhutan aim to resolve a long-running border dispute
- As Techstars retools, some former staffers say it lost focus on what made it successful
- Joan Didion's radical curiosity
- On screen, Father Christmas cuts a mercurial figure
- Communist rappers are luring young disgruntled Chinese
- War, hunger and disease stalk Gaza's 2.2m people
- Why Iran is hard to intimidate
- Hero Journey Club wants to meet gamers' mental health needs, just don't call it therapy
- What Charles III's illness says about monarchs and mortality
- The Time Is Always Now: Soulscapes review – the Black figure reframed to momentous effect
- A Nobel prize for quantum dottiness
- Carmen Callil changed British reading habits for ever
- Technology is deepening civilian involvement in war
- Portugal's prime minister resigns over a corruption scandal
- Blind date: 'She could sweep me off my feet if she tried'
- The British Conservatives' crisis over Rwanda is a rerun of Brexit
- Glued Blades Are the Oldest Ever Found in Europe—and They Weren't Made by Us
- A biographer explores Greta Garbo's glamour and vacuity
- How to Watch Today's Attempted Moon Landing Live
- Microbiome treatments are taking off
- Rohingya refugees return to the sea
- The Skilled Workers Training AI to Take Their Jobs
- Why is Nikki Haley still running?
- Invading Taiwan would be a logistical minefield for China
- An unruly OPEC is causing problems for Russia and Saudi Arabia
- Bill Ackman provides a lesson in activist investing
- Ecuador's president dissolves Congress to avoid impeachment
- Fentanyl kills thousands every year in America. Will Europe be next?
- Rishi Sunak's pyrrhic victory on Rwanda
- Ukraine inches closer to joining the EU
- Business
- Ann Shulgin pioneered the use of psychedelics in therapy
- America's new policing tech isn't cutting crime
- German business is fed up with a government in disarray
- Japan's semiconductor toolmakers are booming
- The travails and bold aims of the Guggenheim Abu Dhabi
- Common sense is not actually very common
- The Story Behind Elon Musk's Tweet Restriction Fiasco
- Vice Media to Stop Publishing on Vice.com, Plans to Cut Hundreds of Jobs
- Cuba's Communist government taps the diaspora for cash
- What gift would you give Narendra Modi?
- Can Ukraine Win This War?
- 'A fabulous ambassador' Flaco, the beloved New York owl, died after building collision
- A national milk-carton shortage sours America's dairy industry
- China is educating engineers around the world
- Economic data, commodities and markets
- Avdiivka falls at last, as Russia presses along the front line
- I Read All 59 of Warren Buffett's Annual Letters. These Are the Best Parts.
- Hong Kong is becoming less of an international city
- Economic data, commodities and markets
- Byju's founder, ousted by shareholders, insists he is still the CEO
- Xi Jinping wants China to have better toilets
- Britain's native farm animals can be rarer than giant pandas
- Douglas Lenat trained computers to think the old-fashioned way
- Chelsea v Liverpool: Carabao Cup final – live
- Trump says he is a 'dissident' under siege from thugs in bleak speech
- China's Communist Party has co-opted ancient music
- How to think about the Google anti-monopoly trial
- The Transport Companies Leaving Fossil Fuels Behind
- JWST Solves Decades-Old Mystery of Nearby Supernova
- Can satellite cities help solve Africa's urbanisation challenges?
- This week's covers
- Ultra-Orthodox Israelis' refusal to fight is a growing problem for Netanyahu
- Xi Jinping wants to be loved by the global south
- George Orwell's horticultural sensibilities
- Economic data, commodities and markets
- How strong is India's economy under Narendra Modi?
- Bankers have reason to hope Trump triumphs
- Why some whales can smell in stereo
- Louisiana Creole is enjoying a modest revival
- Ray Winstone: 'I don't wanna talk about acting!'
- The unfair trial of Jimmy Lai begins in Hong Kong
- Alexei Navalny didn't just defy Putin—he showed up his depravity
- Can Ecuador free itself from the grasp of the drug lords?
- German judges toss a spanner into the government's spending plans
- Why China's rulers fear Genghis Khan
- Politics
- A new book explores the symbiosis of espionage and entertainment
- An Ecuadorian presidential candidate is assassinated
- India bridles at China's growing presence in South Asia
- What is 5G? The Complete Guide to When, Why, and How
- Dominant languages can spread even without coercion
- Riyadh Air is betting on a tourist surge to Saudi Arabia
- The Wendy Williams Documentary: How to Stream It on Lifetime Without Cable - CNET
- When High-Yield Savings Accounts Come With an Asterisk
- How digital gaming spreads far and wide
- A MAGA court in New Orleans is shaping the Supreme Court's agenda
- Go Ahead, Get a Pet Rat
- Could Mark Carney lead Canada?
- Brazil's hinterland now resembles Texas
- Is China understating its own export success?
- North Korea is shutting embassies
- The Korean peninsula is as divided as ever
- Japan's ruling party is in crisis
- Why Beyoncé's 'Texas Hold 'Em' Has Taken Over TikTok
- AI can catalogue a forest's inhabitants simply by listening
- If it can be designed on a computer, it can be built by robots
- Can anyone bar Europe do luxury?
- How to put boosters under India's economy
- Giving the poor a wodge of cash is better than dripping it out
- The war in Ukraine shows how technology is changing the battlefield
- Sources and acknowledgments
- Chord Energy, Enerplus to Combine in $11 Billion Deal
- Reddit's IPO Filing Is Missing Something: Cofounder Alexis Ohanian
- China is stoking anger over Japan's release of nuclear wastewater
- How one pandemic made another one worse
- Politics
- Hudson Valley Weekend Trips: Where to Find the Region's Best New Restaurants, Hotels and Kombucha Sorbet
- The 45 Best Shows on Disney+ Right Now
- 'Highway to horror': 14 wrecked slavers' ships are identified in Bahamas
- The latest billionaire trend? Doomsday bunkers with a flammable moat
- Social-media influencers are battling to educate young Indians about sex
- The best memes of 2021
- Israel hopes technology will help it fight in Hamas's tunnels
- Why are Indians shunning the country's shiny new metro lines?
- Donald Trump's populism is turning off corporate donors
- Few countries are better placed than Vietnam to get rich
- Israelis take little heed of global anger. But their contempt for Netanyahu is growing | Dahlia Scheindlin
- You Say Bitcoin Is Digital Gold? Maybe It's Digital Pearls
- Andriy Pilshchykov pleaded for F-16s to be sent to Ukraine
- Economic data, commodities and markets
- This week's cover
- China's leaders are less popular than they might think
- I Read All 59 of Warren Buffett's Annual Letters. These Are the Best Parts.
- Bitcoin Royalty Descends on the Satoshi Nakamoto Trial
- Best Internet Providers in Arkansas - CNET
- The Morning After: 'Nanosphere' paint could reduce a plane's CO2 emissions
- A guide to the Chinese Communist Party's economic jargon
- Google Tweaked Search to Comply With EU Rules. Yelp Says It Makes Results Even More Unfair
- How a 27-Year-Old Codebreaker Busted the Myth of Bitcoin's Anonymity
- Nemesis - An Offensive Data Enrichment Pipeline
- Narendra Modi's party sweeps in north and central India
- BucketLoot - An Automated S3-compatible Bucket Inspector
- The threat of Hizbullah can be seen from space
- Silvio Berlusconi duped Italians for years
- The Supreme Court will decide how quickly Donald Trump is prosecuted
- Business
- It is getting easier for new entrants to make cars
- Reddit is licensing its content to Google to help train its AI models
- After South Carolina, Trump's March to the Nomination Quickens
- David Bowie delved into his own past on "Toy"
- Should you put all your savings into stocks?
- How First Contact With Whale Civilization Could Unfold
- How scientists are using artificial intelligence
- Britain needs an unprecedented expansion of the electricity grid
- Wall Street titans are betting big on insurers. What could go wrong?
- Japan needs more sperm donors
- The rapid loss of Antarctic sea ice brings grim scenarios into view
- The Sam Altman drama points to a deeper split in the tech world
- Climate talks at last lead to a deal on cutting fossil-fuel use
- How much more cash does Nikki Haley have for her primary run?
- Ethiopia's gambit for a port is unsettling a volatile region
- A changing car industry should result in more choice and better motoring
- Mexico's government is suing American gun manufacturers
- Cheer up, Sir Keir! It might never happen
- Canada's miserly defence spending is increasingly embarrassing
- Belarus votes in tightly controlled elections opposition have called a 'farce'
- British lives are getting duller
- Lawrence MacEwen made a tiny island prosper
- 2054, Part IV: A Nation Divided
- Sources and acknowledgments
- After Russia's invasion the people of Bessarabia switched sides
- My Quest to Fix a Crashing Roku App Provides a Warning About AI
- The war in Ukraine is spurring transatlantic co-operation in tech
- In drought-stricken Europe, leaky pipes are worsening the problem
- Perfect Days review – Wim Wenders's zen Japanese drama is his best feature film in years
- How to sell free trade to green types
- How to entice Japanese couples to have babies
- As the Nikkei 225 hits record highs, Japan's young start investing
- Business
- Israel strikes a hostage deal but promises the Gaza war isn't over
- Could Ukraine's allies be sending it more weapons?
- Reddit cites r/WallStreetBets as a risk factor in its IPO filing
- Lula wants to purge Brazil of Jair Bolsonaro's influence
- The Van Gogh Museum showcases a rejected early masterpiece
- The wrecking of Gaza's health system goes beyond its hospitals
- Turkey is still just a democracy, but it is not certain to remain that way
- Another war could break out on the Israel-Lebanon border
- After it ends, the war in Gaza will still continue to shape Israel
- When My Country Invaded Ukraine, I Faced a Choice: Give Me Propaganda or Give Me Death
- America's immigration policies are failing
- A historian brings to life a 17th-century witchcraft panic
- Economic data, commodities and markets
- Politics
- The latest experimental Threads features let you save drafts and take photos in-app
- How remote islands underpin Japan's maritime power
- Asexuality Research Has Reached New Heights. What Are We Learning?
- The "effective altruism" movement is louder than it is large
- Wind turbines are friendlier to birds than oil-and-gas drilling
- Personal Data Collection: The Complete WIRED Guide
- Wild boar hybrids are raising hell on the Canadian prairies
- The 27 Best Movies on Hulu This Week
- Nestlé Warns on Sales Growth as Inflation Continues to Bite
- Evergrande's liquidation is a new low in China's property crisis
- First Commercial Moon Landing Returns U.S. to Lunar Surface
- Battlefield lessons
- A year on from the white-paper protests, China looks much different
- What Is Blockchain? The Complete WIRED Guide
- How a Canadian company became the world's best acquirer of tech firms
- Australia needs to rethink its approach to its Pacific island neighbours
- How scientists went to an asteroid to sample the Sun
- Dave Bautista Opens Up About His Relationship With Denis Villeneuve
- Oil Market Gets a Russian Lesson: Sell on the Sound of Cannons
- Economic data, commodities and markets
- Sheikh Hasina's party is set to be re-elected in January
- Economic data, commodities and markets
- How motherhood hurts careers
- Will America pull the plug on Israel's invasion of Gaza?
- Many small islands have no room for manoeuvre at COP28
- Why the world's mining companies are so stingy
- Can tech tackle the global crisis of depression and anxiety?
- Leak of Russian 'Threat' Part of a Bid to Kill US Surveillance Reform, Sources Say
- The Heartbreaking Insight of The Boy and the Heron
- How might Donald Trump's trials sway voters?
- Taiwan's presidential election will be a three-way race after all
- 23 Best Wireless Chargers (2024): Pads, Stands, iPhone Docks, and More
- Economic data, commodities and markets
- How Taiwan is shaped by its history and identity
- Rivian to Cut Workforce by 10%
- The British army mulls allowing beards
- The Morning After: These are the first Xbox-exclusive games heading to Switch and PS5
- Britain's Labour Party cuts back its flagship climate-change policy
- The Return of the John Birch Society
- Meet the Japanese Kurds
- Why French women no longer wear high heels
- The real problem with the UN's agency for Palestinians
- A new exhibition shows the visual debt Disney owes to European art
- How Europe's cities stack up in the cost-of-living index
- The 14 Games We're Still Most Looking Forward to In 2024
- Chaim Soutine's Lessons For Today's Refugee Artists
- Under a real peace deal, Gaza could be an intercontinental crossroads
- Los Angeles Just Proved How Spongy a City Can Be
- Dunkin' faces a moo-ving class-action suit from the lactose intolerant
- Economic data, commodities and markets
- Can MSCI drag private markets out of the shadows?
- Politics
- Frequent Heavy Rain Has Made California a Mudslide Hotspot
- Arsenal vs. Newcastle Livestream: How to Watch English Premier League Soccer From Anywhere - CNET
- America's economy is booming. So why are bosses worried?
- Franz Mohr was the man who made great concerts possible
- 2054, Part II: Next Big Thing
- Battles over streaming break out for video games
- Did bitcoin leak from an American spy lab?
- A Celebrated Cryptography-Breaking Algorithm Just Got an Upgrade
- KAL's cartoon
- Nayib Bukele shows how to dismantle a democracy and stay popular
- 'People want our government to do something': Commons Gaza chaos was the day British democracy failed
- Long covid is not the only chronic condition triggered by infection
- The Supreme Court rules against Britain's Rwanda plan. What now?
- Donald Trump's tax cuts would add to American growth—and debt
- South American governments are trying to curb illegal fishing
- Sources and acknowledgments
- Congress might just pass an astonishingly sensible tax deal
- What Sam Altman's surprise sacking means for the AI race
- Vladimir Putin is running Russia's economy dangerously hot
- Taiwan desperately needs support from the world
- Does the tank have a future?
- "Homeland economics" will make the world poorer
- Latin America's local governments too often fail their people
- A Nobel prize in physiology for mRNA vaccines
- An AT&T Outage Is Wreaking Havoc on US Cellular Networks
- What a Serbian cave tells you about the weather 2,500 years ago
- The Houthis have survived worse than America's and Britain's strikes
- The Chinese yuan is losing value, yet gaining ground
- Peng Ming-min fought for the idea of "one China and one Formosa"
- David Kirke believed safe sport repressed people's imaginations
- A $35bn mega-merger strengthens a quiet chip duopoly
- Kin of Italian victims of Nazis may finally get compensation
- Why AI needs to learn new languages
- The next threat to commodity supplies will be El Niño
- Blind date: 'We met eyes and squeezed each other's hands. It felt intimate'
- Reddit downplays risks of developer backlash, decentralized social media in its IPO filing
- Ukraine takes an important step towards EU membership
- Russia's bid to return to the Moon comes to an ignominious end
- Two women are vying to be Mexico's next president
- Scottish nationalism's left turn
- Business
- Will Rishi Sunak's reshuffle make a difference in the polls?
- The global backlash against climate policies has begun
- This week's covers
- External shocks have hit the Italian economy hard
- Jurassic League May Be DC's Next Animated Movie
- The genocide case Israel faces is more about politics than the law
- Intel's CEO Says AI Is the Key to the Company's Comeback
- Nissan's investment will not restore Britain's car industry to glory
- The pharmacist will see you now
- Xiaomi 14 Ultra combines a 1-inch camera sensor with four AI imaging models
- Colonies of bacteria could save the Pentagon billions
- Press freedom is stifled in Guatemala ahead of an election
- Economic data, commodities and markets
- The return of The Economist's agony uncle
- The Belt and Road, as seen from China
- Arc browser's new AI-powered 'pinch-to-summarize' feature is clever, but often misses the mark
- Arsenal falter in Porto and Liverpool's Luton scare – Football Weekly Extra
- SwaggerSpy - Automated OSINT On SwaggerHub
- Star Trek: Discovery's Crew Preps for Their Last Dance in New Season 5 Trailer
- In Japan, festivals are boldly taking art into the countryside
- 'Peppa Is a Brat': Parents Turn on the Cheeky Preschooler Pig
- Tinder Owner Signs ChatGPT Deal. Enjoy the AI Dating Tidal Wave
- Jury finds NRA, Wayne LaPierre liable in civil corruption case
- The feud between Ukraine's president and army chief boils over
- Introducing Essential India, our latest newsletter
- How the seven-day week came to rule the world
- Elizabeth II never laid down the heavy weight of the crown
- Google's sign-in and sign-up pages have a new look
- China says it has achieved a miraculously low-crime society
- Young Latin Americans are unusually open to autocrats
- Costly food and energy are fostering global unrest
- What four more years of Joe Biden would mean for America's economy
- Europe faces a painful adjustment to higher defence spending
- Gazans are rapidly losing access to the internet
- Galaxy S22 Deals: Get Up to $750 Off With Carrier Plans and Trade-In - CNET
- Delivery robots will transform Christmas
- Economic data, commodities and markets
- 'I like ego but it needs to be channelled': Toto Wolff on how he harnessed Hamilton's ability
- Researchers in China create the first healthy, cloned rhesus monkey
- Former justice secretary calls out Tory party colleagues over 'dangerous' rhetoric
- Is the 100-year old TB vaccine a new weapon against Alzheimer's?
- Thailand's new government is handing out cash
- Xi Jinping's chaos-loving friends
- James Lovelock changed the way human beings look at the Earth
- Robert Kirkman Seemingly Kills Dreams Of an Invincible/Spider-Man Team-Up
- KAL's cartoon
- Bernard Ingham and Betty Boothroyd ensured democracy worked as it should
- Europe is importing a solar boom. Good news for (nearly) everyone
- Babysitting duties are stressing China's grandparents
- Accidental ocean floor discovery solves 120-year-old mystery of coal ship disappearance
- A new diplomatic struggle is unfolding over Taiwan
- Australians are no longer united on Aboriginal rights
- Xbox's Hi-Fi Rush is coming to PS5 on March 19
- American journalism sounds much more Democratic than Republican
- Business
- A genocidal militia is winning the war in Sudan
- How did the Iowa result change the Republican primary?
- Lawmaking in Britain is becoming worse
- Donald Trump does exactly what he was expected to do
- The favourite in Indonesia's presidential election has a sordid past
- Nvidia CEO Jensen Huang Is Powering the AI Revolution
- 'Embarrassing and wrong': Google admits it lost control of image-generating AI
- Universal Antivenom for Snake Bites Might Soon Be a Reality
- A new year's message from the CEO
- The Transport Companies Leaving Fossil Fuels Behind
- 'AI Girlfriends' Are a Privacy Nightmare
- Data from satellites suggest violence has surged in much of Sudan
- How the young should invest
- Was an ancient bacterium awakened by an industrial accident?
- KAL's cartoon
- Netflix takes a swing at live sport
- How China uses UNESCO to rewrite history
- Trump the Survivor
- Who made millions trading the October 7th attacks?
- Germany's ruling coalition grapples with a wrecked budget
- 'The Architect of Berkshire Hathaway:' Warren Buffett Honors Charlie Munger
- Bernardo Arévalo is still battling to become Guatemala's president
- AMLO's austerity has hurt Mexico
- NATO is drafting new plans to defend Europe
- Nvidia CEO Jensen Huang Is Powering the AI Revolution
- The disappearance of China's defence minister raises big questions
- Best Verizon Plans: How to Choose and Which Ones to Pick in 2024 - CNET
- Cambodia's genocide is still hurting its people
- Premium Indian whisky is booming
- The 2024 Election May Be Decided By Nonvoters. If They Vote.
- How confusing fetal-personhood laws in America affect hospitals
- Who will fill the expelled George Santos's seat?
- Why British police should focus on victims
- The Extremely Large Telescope will transform astronomy
- What can inflation-strugglers learn from inflation-killers?
- KAL's cartoon
- Many of the world's new mpox cases are in China
- Lula's ambitious plans to save the Amazon clash with reality
- A Re-established West Bank Settlement Symbolizes Hardened Israeli Views
- China heaps pressure on Taiwan ahead of a big election
- What's an Influencer? The Complete WIRED Guide
- China's enormous surveillance state is still growing
- Oppo Find X7 Ultra Review: Magnificent Camera
- Sri Lankans are squabbling over monuments
- Apollo's Sequel Will Be a Gold Rush
- He Doubted He'd Find 'the One.' She Made Him a Believer.
- KAL's cartoon
- As Ukrainian men head off to fight, women take up their jobs
- An accidental discovery in rural California raised biosecurity fears
- Are NYCB's troubles the start of another banking panic?
- "Grief camps" help Ukrainian children face the loss of parents
- Could carbon credits be Africa's next big export?
- With Sam Altman's return, a shift in AI from idealism to pragmatism
- A leaked recording shakes up the Republican Party in Arizona
- Abdulrazak Gurnah wins the Nobel prize in literature for 2021
- The 57 Best Movies on Disney+ Right Now
- A new book celebrates Annie Leibovitz's fashion photography
- 17 Tips to Take Your ChatGPT Prompts to the Next Level
- "Making Nice" is a gratifying satire of the internet age
- The best books of 2021
- Air Canada Has to Honor a Refund Policy Its Chatbot Made Up
- Ron Galella, the original paparazzo, died on April 30th, aged 91
- Macron opens Paris agricultural fair to protests from farmers
- Hong Kong gets a second draconian security law
- Comb-Over No More: Why Men's Hair Transplants Are Flourishing
- The Middle East faces economic chaos
- Politics
- The world's richest countries in 2023
- Why are Americans so gloomy about their great economy?
- The Economist's cost-of-loving index
- Are politicians brave enough for daredevil economics?
- swaggerHole - A Python3 Script Searching For Secret On Swaggerhub
- The old bank/card model is still entrenched in the rich world
- A four-pack of AirTags is $20 off right now
- What Ukraine's bloody battlefield is teaching medics
- A Chinese opera star's ode to Russia—from a Ukrainian bomb site
- A new Suez crisis threatens the world economy
- How scared is China of Donald Trump's return?
- Gang violence is spreading across Latin America
- Nicaragua's dictator goes after Miss Universe
- In praise of America's car addiction
- The culture wars have come to Canada
- 2054, Part V: From Tokyo With Love
- Wes Streeting, a Labour frontbencher, visits Singapore
- The success of "Succession" proves the virtue of hateful characters
- Israel's truce with Hamas is drawing to a close
- A religious revolution is under way in the Middle East
- Pemex is the world's most indebted oil company
- KAL's cartoon
- How a Shifting AI Chip Market Will Shape Nvidia's Future
- KAL's cartoon
- Donors are already mulling a Marshall Plan for Ukraine
- The Qatar World Cup shows how football is changing
- Middle East crisis live: Iran says US and UK strikes on Houthis 'escalate tensions'; Qatar reportedly to host Hamas-Israel truce talks
- Readers reply: does spam email actually work?
- Gab's Racist AI Chatbots Have Been Instructed to Deny the Holocaust
- Stopmotion Brings an Artist's Harrowing Meltdown to Life
- Ranajit Guha revolutionised the study of India's past
- Solar geoengineering is becoming a respectable idea
- Attacks on shipping in the Red Sea are a blow to global trade
- Why American manufacturing is becoming less efficient
- A difficult new world
- Open-source intelligence is piercing the fog of war in Ukraine
- Pansonic's powerful Lumix S5 II is $800 off with a prime lens
- Yes, It's Rude to Use Your Laptop During Meetings---and More Tech Etiquette Rules You Might Be Breaking
- There are risks but also big potential benefits from digital payments
- 20 Best Portable Battery Chargers (2024): For Phones, iPads, Laptops, and More
- Saudi Arabia has an unlikely solar star
- After banning cinema for decades, Saudi Arabia is making movies
- Tyrant, liberator, warmonger, bureaucrat: the meaning of Napoleon
- Which city is the cheapest in the world?
- Samsung's boss avoids prison, again
- Elinor Otto did not realise what giant strides she was making for women
- Women's football is becoming bigger and better
- Cuba's private-sector experiment is faltering
- Gareth Edwards Dropped Everything to Be Jurassic World's Next Director
- U.S. Conducts More Strikes Against Houthi Targets in Yemen
- Rocking the boat: would your marriage survive being shipwrecked together?
- China is stoking a controversy in order to influence Taiwan's election
- KAL's cartoon
- Has Twitter (now X) become more right-wing?
- Catholic reformers want big changes to a church marred by sex abuse
- Australia's enthusiasm for immigration is being tested
- Tina Turner turned a tough life into splendour
- Danone Income, Margins Rise on Higher Volumes
- New industrial policies will not help economic stability
- On the 50th anniversary of "Ways of Seeing" and "G."
- The rich world claims it has paid its overdue climate debts
- How to change the policy of the British government
- Israeli Police Clash With Protesters Calling for Early Elections
- Politics
- The trouble with reality in fiction
- Peter Schickele and P.D.Q. Bach were sides of the same coin
- The path ahead for China's Belt and Road Initiative
- The world's deadliest war last year wasn't in Ukraine
- What is the world's loveliest language?
- 'Diablo IV' Heads to Game Pass as Microsoft Eyes 4 Games to Expand Beyond Xbox
- Kyiv Is Using Homegrown Tech to Treat the Trauma of War
- Sony is working on official PC support for the PS VR2
- Good evening, Ms Bond. We've been expecting you
- SpaceX Launched Military Satellites Designed to Track Hypersonic Missiles
- For Hannah Pick-Goslar, paths crossed in an extraordinary way
- Propane-powered heat pumps are greener
- Costa Rica no longer seems a Latin American success story
- What Is the Internet of Things? A WIRED Guide
- A Vending Machine Error Revealed Secret Face Recognition Tech
- Economic data, commodities and markets
- After 12 years of blood, Assad's Syria rejoins the Arab League
- "Don't Look Up", Adam McKay's political farce, is bleakly realistic
- India's surging food prices are a problem not just for India
- No-strings philanthropy is giving charities more decision-making power
- Welcome to a golden age for workers
- Best Standing Desks of 2024 - CNET
- Vladimir Putin extends his crackdown in Russia
- The Second City, named for its Chicago location, opens an outpost in New York
- From lab to plate: a six-course banquet featuring no-kill dim sum and steak frites
- Far-right ideas are gaining a renewed respectability in France
- The Mexican president's latest boondoggle officially opens
- China's aggression brings Japan and the Philippines closer
- Economic data, commodities and markets
- The pandemic has broken a closely followed survey of sentiment
- KAL's cartoon
- Should you send your children to private school?
- The Washington Book review: Carlos Lozada on Trump and other targets
- An Insightful and Truly Fun Cooking Show
- Should every schoolchild eat free?
- The fading legacy of Sandra Day O'Connor, a trailblazing justice
- Chicago Becomes the Latest City to Sue the Oil Industry over Climate Change
- Can Giorgia Meloni reinvigorate Italia SpA?
- Inside the banter-industrial complex
- SpaceX tests Starship, and prepares to face down Amazon
- The People's Liberation Army is not yet as formidable as the West fears
- Jair Bolsonaro is barred from office for eight years
- Why China's government is hushing up court rulings
- Towns in eastern Ukraine fear they will be Russia's next target
- A landslip in Hong Kong fuels resentment of the rich
- America's crumbling trade initiative in Asia
- Pervez Musharraf was one of Pakistan's better dictators
- The horror story of HS2
- The Supreme Court is torn over Purdue Pharma's opioid settlement
- China edges towards a big bail-out
- The Chinese Communist Party wants (a bit) less consumer internet
- How to get African oil out of the ground without Western lenders
- Ready, player four billion: the rise of video games
- Firms are exploring sodium batteries as an alternative to lithium
- Lab-grown models of embryos increasingly resemble the real thing
- Does Europe at last have an answer to Silicon Valley?
- The Hollywood Foreign Press Association does penance for its sins
- Hard times for China's micro-industrialists
- Canadians are starting to sour on migration
- Welcome to the new era of global sea power
- Turkey has a newly confrontational foreign policy
- Did America thwart an Indian assassination plot?
- A memo to Britain's chancellor, Jeremy Hunt
- Ban it harder! An unwelcome new trend in British politics
- Why politicians are obsessed with mythical Chinese land grabs
- Rosemary Smith set out to prove that women drivers could do as well as men
- Does America have enough weapons to support its allies?
- Will spiking shipping costs cause inflation to surge?
- Economic data, commodities and markets
- How Ukraine's enemy is also learning lessons, albeit slowly
- Chelsea vs. Liverpool Livestream: How to Watch Carabao Cup Final Soccer From Anywhere - CNET
- Can the carbon-offset market be saved?
- Sean Baker's films bring sex work into the light
- The 31 Best Shows on Amazon Prime Right Now
- A short history of Russia and Ukraine
- NVIDIA is testing an app that unifies GeForce Experience and Control Panel
- Europe's grumpy farmers are a symptom of wider malaise
- Forget the S&P 500. Pay attention to the S&P 493
- Move fast and mend things
- Geert Wilders's election win leaves the Dutch in an awful quandary
- Saleemul Huq lobbied ceaselessly to make poor countries heard
- Xbox Game Pass Is More Enticing Than Ever With Diablo 4 - CNET
- MWC 2024: Anticipating the Coolest Phone Tech, Concepts and Surprises - CNET
- South Korea's writers and directors play Squid Game
- Economic data, commodities and markets
- Software is now as important as hardware in cars
- Why are so many of the victims in Gaza children?
- China tells its citizens to be on the lookout for spies
- The excitement of 70,000 Swifties can shake the Earth
- Business
- How China became a car-exporting juggernaut
- 'Reality remains tough as ever', says Japan PM as extra $660m pledged for Noto earthquake rebuild
- MrHandler - Linux Incident Response Reporting
- Mary Quant launched the clothes that made the Sixties swing
- Reddit Is Letting Power Users In on Its IPO. Not Everyone's Buying
- Ukraine's commander-in-chief on the breakthrough he needs to beat Russia
- [36. Violence: Patri-confessional]
- This Tiny Website Is Google's First Line of Defense in the Patent Wars
- Introducing El Boletín, our new weekly newsletter on Latin America
- Elmore Nickleberry pinned his hopes to Martin Luther King
- Acknowledgments
- Hong Kong is struggling to restore its image as a global city
- 7 Best Space Heaters to Warm Your Home in 2024 - CNET
- Video: insights from the author
- Standard Chartered Unveils $1 Billion Buyback, Guides for Growth
- The growing global movement to restrain house prices
- This week's covers
- Politics
- What drives people to vote the way they do?
- Economic data, commodities and markets
- Elon Musk v labour unions: Sweden edition
- American stocks loiter near an all-time high
- What Russia's budget reveals about the war in Ukraine
- China's shoppers are gloomy and picky
- The Skilled Workers Training AI to Take Their Jobs
- Carolyn Bryant's was the testimony that doomed Emmett Till
- Economic data, commodities and markets
- China's deep-water fishing fleet is the world's most rapacious
- India's civil society is under attack
- Opinion: Welcome to Payola World!
- Vaping is big business in Britain
- Israel is more popular than social-media posts suggest
- Will Trump abandon Ukraine if he wins in November? – podcast
- How to Dry Off a Soaked iPhone (Don't Use Rice)
- Ten charts compare Joe Biden's record with Donald Trump's
- China's cities compete for kids
- How Portugal eased its opioid epidemic, while U.S. drug deaths skyrocketed
- China is struggling to recruit enough highly skilled troops
- This week's covers
- The head of the hard-right Alternative for Germany is riding high
- All parties are blaming each other for the dire situation in Gaza
- America's economic might gives it little sway in the Middle East
- The map for the next British election has been redrawn
- Sweden clears a Turkish hurdle to NATO accession
- Heart Health: Tips and Recipes to Help You Master the Mediterranean Diet - CNET
- Welcome to the era of AI nationalism
- Section 702 Surveillance Fight Pits the White House Opposite Reproductive Rights
- The Pentagon is hurrying to find new explosives
- Oscars 2024: best picture nominees – reviews, awards and where to watch
- An Evolutionary 'Big Bang' Explains Why Snakes Come in So Many Strange Varieties
- Britain's Post Office scandal is a typical IT disaster
- As Donald Trump threatens NATO, the Baltic states stiffen their defences
- A Startup's Mission to Bring Back the Woolly Mammoth Is Being Made Into a Docuseries
- The 35 Best Shows on Hulu Right Now
- Trump wins South Carolina's GOP primary as Haley vows to stay in the race
- Ocean Temperatures Keep Shattering Records—and Stunning Scientists
- What Is Quantum Computing? The Complete WIRED Guide
- Does the American army's future lie in Europe or Asia?
- Plunging fertility rates are creating problems for Latin America
- Russia's opposition has lost a crucial leader but gained a martyr
- When China thought America might invade
- A Google AI has discovered 2.2m materials unknown to science
- Xbox controllers are on sale for $44 each, plus the rest of the week's best tech deals
- This year's El Niño will hit Peru especially hard
- The pandemic's toll on schooling emerges in awful new exam results
- Why African businesses take a DIY approach to selling online
- Natural Gas Hasn't Been This Cheap in Decades
- Leaning into Lent: whether believer or agnostic, there are lessons for us all | Justine Toh
- Why house prices have risen once again
- Iran rethinks its role as a regional troublemaker
- Fortescue First-Half Net Up 41%, Raises Dividend
- As Trading Frenzies Grip Penny Stocks, Criticism of Nasdaq Grows
- Attacks on shipping threaten to upend peace talks in Yemen
- Economic data, commodities and markets
- Could AI transform science itself?
- How to live to one hundred
- Just how bad is it in Gaza?
- Mangosuthu Buthelezi had his own vision for a democratic South Africa
- Sources and acknowledgments
- Tiny hitchhikers on viruses could promote resistance to antibiotics
- Keir Starmer, Reform UK and Britain's populist paradox
- They Rode the Rails, Made Friends, and Fell Out of Love With America
- Milan Kundera believed that truth lay in endless questioning
- On Gaza, Europe is struggling to make its diplomacy matter
- Economic data, commodities and markets
- The Economist's science and technology internship
- The Transport Companies Leaving Fossil Fuels Behind
- How to restore Britons' confidence in the police
- Data on air bases suggest a Chinese invasion of Taiwan may not be imminent
- Politics
- Humans have altered other species as well as the environment
- When your colleagues are also your rivals
- Techstars CEO defends changes, says physical presence in a city is not necessary for investment
- How Britain plans to cut immigration
- Andrés Manuel López Obrador puts his stamp on Mexico's schools
- Xi Jinping looks abroad for confidence
- How the red beret became Africa's most political hat
- Six-Word Sci-Fi: Stories Written by You
- It's Basketball's Ugliest Shot. And It Just Keeps Going In.
- Unknown soldiers
- Meet Javier Milei, the front-runner to be Argentina's next president
- The renewables business faces a make-or-break moment
- Politics
- Political Ads Can Target Your Personality. Here's What Could Go Wrong
- An animated documentary tells the story of Amin, an Afghan refugee
- Geert Wilders's Dutch election win is a headache for Europe
- Hundreds jailed for coming to UK in small boats to claim asylum, says report
- Economic data, commodities and markets
- Sung Tieu unpacks "Havana syndrome" in her latest work
- Asia's most expensive cities, ranked
- How successful is egg-freezing at preserving fertility?
- Sources and acknowledgments
- GiveDirectly does what it says on the tin
- Israel's Supreme Court strikes back
- The ever-expanding Middle East war
- The WIRED Guide to Digital Security
- Vladimir Putin says the world's energy infrastructure is "at risk"
- Oppenheimer movie dominates SAG Awards, while Streisand wins lifetime prize
- Odysseus Lander Touches Down on the Moon
- The Turkish economy is in pressing need of reform and repair
- New Orleans Catholic priest charged with rape may be too sick to stand trial
- 2054, Part I: Death of a President
- Bar culture has arrived in Saudi Arabia, albeit without the booze
- Republican primaries poll tracker: can anyone beat Donald Trump?
- Jean-Jacques Sempé was an unparalleled observer of the human condition
- "The Harder They Fall" offers a new take on the Old West
- Japan lands on the Moon
- Russia outsmarts Western sanctions—and China is paying attention
- Inside Hamas's sprawling financial empire
- Hilary Mantel saw things that others couldn't
- Social-Media Company Reddit Files for IPO
- America's shuttle diplomacy to wind down the war in Gaza
- Imperial borders still shape politics in Poland
- Google Pay app is shutting down in the US later this year
- Politics
- After WeWork's fall, what next for SoftBank?
- ReelShort is the latest Chinese export to conquer America
- Belfast rappers Kneecap on stunts, drugs and Kemi Badenoch: 'We don't discriminate who we piss off'
- Volodymyr Zelensky tries to shake Congress out of paralysis
- Erdogan's empire
- Europe, not America, is now Ukraine's largest backer
- Anger Can Help You Meet Your Goals
- The firepower of Iran-backed militias, in maps
- What would Europe do if Trump won?
- Secbutler - The Perfect Butler For Pentesters, Bug-Bounty Hunters And Security Researchers
- China is trying to boost domestic tourism
- Booming cocaine production suggests the war on drugs has failed
- At Christmas, Europeans look less united than ever
- Moon landing apart, Indian science punches far below its weight
- How wild horses sparked a culture war in Australia
- Xi Jinping worries that China's troops are not ready to fight
- The Irony of the Sephora Tweens
- Jensen Huang says Moore's law is dead. Not quite yet
- Dictators and utopians are fond of fiddling with constitutions
- Why you have an accent in a foreign language
- The curious case of Nick Clegg
- The search for justice in America is not a nine-to-five job
- Why fake research is rampant in China
- KAL's cartoon
- Could AI help find valuable mineral deposits?
- Nvidia CEO Jensen Huang Is Powering the AI Revolution
- This Official Poor Things Party Brought the Film's Freaky Glam Vibes to Life
- Pakistan's voters tell the generals where to put it
- X starts giving non-paying users the ability to make audio and video calls
- Worried About a Market Crash, He Invested in a Depression-Era Car
- India's Supreme Court refuses to recognise same-sex marriage
- How common infections can spark psychiatric illnesses in children
- The dividend is back. Are investors right to be pleased?
- A Nobel prize for electron-watchers
- Instead of undoing Ataturk's legacy, Recep Tayyip Erdogan has claimed it
- Animals can be tracked by simply swabbing leaves
- Donald Trump's Iowa operation suggests his campaign will be formidable
- Are India's corruption police targeting Narendra Modi's critics?
- Odysseus Marks the First US Moon Landing in More Than 50 Years
- America's university graduates live much longer than non-graduates
- Sierra Says Conversational AI Will Kill Apps and Websites
- The week in wildlife – in pictures: four rare Amur leopards, perching puffins and a hungry fox
- This week's covers
- Martyr! by Kaveh Akbar review – riotous tale of a grieving son
- Husband Who Eavesdropped on Wife's Work Calls Pleads Guilty to Insider Trading
- Many Arab governments would like to see Hamas gone
- Mati Diop's documentary Dahomey wins top prize at Berlin film festival
- Between Layoffs and Tougher Interviews, Tech Workers Are Stressed Out
- Frontline Formosa
- The One Internet Hack That Could Save Everything
- The clock is ticking on an old deal between America and China
- Climate will be a battleground in Britain's next election
- Is America's EV revolution stalling?
- Using books as interior design? It's a trend with a tale
- Outrage against femicide is spreading in Italy
- Richard Simpson strove to balance buyers against manufacturers
- Are American children's books getting more "woke"?
- Brother Andrew secretly carried Bibles behind the Iron Curtain
- Let's talk about Xbox | This week's gaming news
- Why Costco is so loved
- After 50 years, the Residents are still on the road
- In preparing for disasters, museums face tough choices
- Treating a chatbot nicely might boost its performance — here's why
- Which languages take the longest to learn?
- What David Cameron's return says about British politics
- Nicolás Maduro, Venezuela's dictator, thumbs his nose at Joe Biden
- AT&T Network Back Online After Nationwide Outages
- Highlights of a year when art mattered as much as ever
- China's "demographic dividend" appears to be a myth
- How to master the art of delegation
- Why car insurance in America is actually too cheap
- Mexico's president and his family are fighting claims of corruption
- Finding aliens means studying new sorts of planet
- Narendra Modi is remaking India's 1.4m strong military
- Defying China, Taiwan elects William Lai Ching-te as president
- The forgotten importance of the War of Jenkins' Ear
- Google's Chess Experiments Reveal How to Boost the Power of AI
- Why bitcoin is up by almost 150% this year
- A Startup's Mission to Bring Back the Woolly Mammoth Is Being Made Into a Docuseries
- Daniel Brush's drive to understand beauty led him to the life of a hermit
- Barry Humphries, creator and manager of Dame Edna Everage, died on April 22nd, aged 89
- Real wages have risen in America and are rebounding in Europe
- I never want to go to a festival again, but UK music would be lost without them | Barbara Ellen
- The science of IVF: What to know about Alabama's 'extrauterine children' ruling
- Latin America's armed forces have increasing clout
- How American states squeeze athletes (and remote workers)
- A mining project revives a dying Bosnian town
- Can Arc'teryx's owner revive Chinese IPOs in America?
- 'I said something wrong': Paul McCartney reveals origin of Yesterday lyric
- The future lies with electric vehicles
- 'Ukraine fatigue': why I'm fighting to stop the world forgetting us – podcast
- Frank Drake believed that the universe had to contain other intelligent beings
- Britain's Labour Party is backed by a pro-growth coalition
- With liquidity rare, VCs may get creative to return investor cash
- Don't blame "quiet quitting" on Gen-Z
- Mario Terán was the man sent to kill Che Guevara
- Economic data, commodities and markets
- Corals are bleaching and dying earlier in the year than ever before
- What the death of America's border bill says about toxic congressional politics
- What Is 5G Home Internet? Is It All Hype? Separating Fact From Fiction - CNET
- Five reasons why Indonesia's election matters
- Philanthropy in Asia is becoming more professional
- Scientists have found a new kind of magnetic material
- The new geishas
- Sandra Day O'Connor specialised in breaking into male bastions
- China is quietly reducing its reliance on foreign chip technology
- Binyamin Netanyahu is at the mercy of his hardline coalition partners
- Ten charts reveal Narendra Modi's actual record in office
- Google's AI Boss Says Scale Only Gets You So Far
- China is mostly quiet on Houthi attacks in the Red Sea
- Why migration is in such a mess once more
- A new nuclear arms race looms
- Quick thinking and a stroke of luck averted a moon lander disaster for Intuitive Machines
- Signal Finally Rolls Out Usernames, So You Can Keep Your Phone Number Private
- The Atlantic Diet: Why Eating Local, Whole Foods May Improve Your Health - CNET
- Sources and acknowledgments
- How many Russian soldiers have died in Ukraine?
- Britain's mental-health crisis is a tale of unintended consequences
- Anglo American Lower Profit Tops Hopes But Cuts Payout
- KAL's cartoon
- Emmanuel Macron's vision of a more muscular Europe is coming true
- Save $50 on the Pixel Watch 2 - CNET
- Israel isn't sure what to do about the hostages in Gaza
- KAL's cartoon
- A year after its liberation, Kherson still knows fear—and defiance
- The case of China's vanishing chairmen
- The Politics of Noise and Silence
- US ambassador Caroline Kennedy prepares for Shitbox Rally across outback Australia
- A Chinese dispute with the Philippines is a test of America
- The rise of user-created video games
- Stolpersteine grieve for victims of the Nazis, one at a time
- Sinéad O'Connor hated the very idea of being a pop star
- The 2023 crony-capitalism index
- Array Collective, a group from Belfast, wins the Turner prize
- Review: 'Final Fantasy VII Rebirth' Sets a New High for the Series
- What Defines Artificial Intelligence? The Complete WIRED Guide
- Companies run to their own annual rhythms
- The outsize influence of small states is fading in the EU
- America braces for Taiwan's election—and vice versa
- Economic data, commodities and markets
- Politics
- Your older S23 phone will get Samsung's Galaxy AI suite in late March
- The Putin Show
- Spain's institutions are groaning under partisan pressure
- Metal Prices Are Soaring. So Is Metal Theft
- This week's covers
- China's persecution of Uyghurs extends to those it once favoured
- The world's biggest maker of spectacles wants to be a tech firm
- Russia tries to overwhelm Ukraine with missiles
- Economic data, commodities and markets
- Ukraine's defence minister says half of western arms arrive later than promised
- Bitcoin Royalty Descends on the Satoshi Nakamoto Trial
- China is struggling with a surge of respiratory ailments
- One in five young Americans thinks the Holocaust is a myth
- Economic data, commodities and markets
- Has Australasia lurched right on race?
- Three countries hit by coups are leaving west Africa's main bloc
- Joe Biden's failures on trade benefit China
- As China's markets suffer, what alternatives do investors have?
- Air Canada Has to Honor a Refund Policy Its Chatbot Made Up
- A digital payments revolution in India
- WIRED's 11 Noteworthy Long-form Stories of 2023
- There's a New Theory About Where Dark Matter Is Hiding
- Nvidia Shares Electrify Markets Around the Globe
- Economic data, commodities and markets
- From duck stamps to doomsday: the past year in American politics
- China is sending escapers back to North Korea
- The world's population has reached 8bn. Don't panic
- Peter Thiel's $100,000 Offer to Skip College Is More Popular Than Ever
- Paula Rego was a painter of rage, longing and loneliness
- The housing ladder, 1950-2005
- Economic data, commodities and markets
- Britain has seen an alarming rise in poetry sales
- How working from home is reshaping Canary Wharf
- State attorneys-general are shaping national policy
- The false promise of green jobs
- The Ukrainian army commits new forces in a big southward push
- Tech Leaders Fled San Francisco During the Pandemic. Now, They're Coming Back.
- The ancient Eleusinian mysteries get a new incarnation
- Around the world, bans do not make abortion much rarer
- How Donald Trump Became Unbeatable
- In defence of a financial instrument that fails to do its job
- The false promise of Indonesia's economy
- How to kill a goose quickly
- Lenovo Snaps Revenue Declines, Bets On AI-Powered Tech
- Why are Latin American workers so strikingly unproductive?
- As Medicaid Shrinks, Clinics for the Poor Are Trying to Survive
- Why China and India are watching the Dalai Lama closely
- CVE-2024-23897 - Jenkins <= 2.441 & <= LTS 2.426.2 PoC And Scanner
- This Solar Eclipse Simulator Helps You Find the Best Place to Watch From
- Stompy - Timestomp Tool To Flatten MAC Times With A Specific Timestamp
- Israel is strangling the West Bank's economy
- Hong Kong's problems trace back to China. And also America
- AT&T restores cellphone service after US outage affecting thousands of users
- Why prosthetic limbs need not look like real ones
- Boris Johnson: star turn at Britain's covid inquiry
- How Nevada's Republicans made their primary irrelevant
- "Trading Places" and the challenge of troubling art of the past
- Traute Lafrenz showed that resistance to the Nazis was possible
- Why chinstrap penguins sleep thousands of times a day
- Short of cash, Brazil's government may end its gambling prohibition
- A New Type of Cancer Drug Shrinks Hard-to-Treat Tumors
- Jürgen Klopp and the importance of energy
- What is The Economist's word of the year for 2021?
- Business
- Europe decides it doesn't like lab-grown meat before it's tried it
- Apple's Vision Pro headset ushers in a new era of personal technology
- Economic data, commodities and markets
- Southern Europe's employment boom is not strong enough
- Fifteen notable lives lost in 2022
- Why are cities in Latin America getting more expensive?
- AT&T Says Outage Wasn't Cyberattack Despite Widespread Conspiracy Theories Online
- Why German bosses are heaping unexpected praise on France
- The old have come to dominate American politics
- How science will be transformed by AI
- Has Team Transitory really won America's inflation debate?
- Business
- Gucci, Prada and Tiffany's bet big on property
- RepoReaper - An Automated Tool Crafted To Meticulously Scan And Identify Exposed .Git Repositories Within Specified Domains And Their Subdomains
- The spat with India only adds to Justin Trudeau's woes
- How not to motivate your employees
- SAG awards and lantern festivals: photos of the weekend
- Moviemaking and gamemaking are converging
- Elon Musk's Latest Robot Video Looks Like It Was Shot on a Phone From 2002
- Attempts to make supply chains "resilient" are likely to fail
- Economic data, commodities and markets
- Russia's plan to seduce Christians in Africa
- An espionage case hurts Chinese relations with Australia
- America's border crisis in ten charts
- Joe Biden lifts sanctions on Venezuela, but not without conditions
- It's the End of the Web as We Know It
- An American rocket has a fine debut; not so the Moon lander on board
- How to survive a superpower split
- Mistakes, fakes, and a giant rat penis: why are so many science papers being retracted? – podcast
- Sources and acknowledgments
- Politics hamper China's efforts to stimulate the economy
- America's pandemic savings are running out
- Data Breaches: The Complete WIRED Guide
- Venezuela's autocrat, Nicolás Maduro, threatens to annex Guyana
- Congo's crucial election may be heading for disaster
- Economic data, commodities and markets
- Can China's consumers save its economy?
- Reviving ancient viruses can help fight modern ones
- The best television shows of 2021
- Inside the shared studio of Thom Yorke and Stanley Donwood
- The culture war over the Gaza war
- How to win the culture war
- Disney Reveals a New Look at Splash Mountain's Princess and the Frog Makeover
- The A-Z of US politics
- 19 Best Mattress and Bedsheet Deals Right Now
- After winning New Hampshire, Trump is cruising to the nomination
- A brutal battle for southern Gaza beckons once the truce ends
- Economic data, commodities and markets
- The dwindling of the Panama Canal boosts rival trade routes
- Why you should never retire
- What Does It Really Mean to Be 'Codependent'?
- How men with guns aggravate global hunger
- Metal Prices Are Soaring. So Is Metal Theft
- What revolt at OpenAI means for Microsoft
- Over a million Paraguayans disappear in the latest census
- Britain's worst miscarriage of justice sparks outrage at last
- Belarus prepares for another fraudulent election
- My Parents' Dementia Felt Like the End of Joy. Then Came the Robots
- Economic data, commodities and markets
- Business
- Counting Britain's beauties and leech-bleeders
- China tries to figure out whom a hit song is mocking
- How ants persuaded lions to eat buffalo
- The Strangest Job in the World
- Why Britain's homes will need different types of heat pump
- Sources and acknowledgments
- Who is in charge of Europe?
- What is Crispr Gene Editing? The Complete WIRED Guide
- Climate Change: The Complete WIRED Guide
- Western armies are learning a lot from the war in Ukraine
- BookTok has passion—and enormous marketing power
- The first endometriosis drug in four decades is on the horizon
- A Mysterious Leak Exposed Chinese Hacking Secrets
- The world this week
- Investors are increasingly optimistic about Brazil's economy
- Indians are going gooey over dogs
- Our favorite instant-read meat thermometer is on sale for $79
- When My Country Invaded Ukraine, I Faced a Choice: Give Me Propaganda or Give Me Death
- China and the EU risk a trade war
- A $150 Billion Question: What Will Warren Buffett Do With All That Cash?
- Britain's cost-of-living squeeze will leave an enduring mark
- Do You Live in One of the 15 States Sending Child Tax Credits in 2024? Find Out Here - CNET
- Russia's war is splitting the indigenous Sami in two
- A centre-right maverick, Pieter Omtzigt, could win the Dutch election
- What tennis reveals about AI's impact on human behaviour
- Why Agnes Chow fled Hong Kong and isn't likely to return
- Starry new productions show "Macbeth" is the tragedy for our times
- Nvidia Sales Reach New Heights as Company Forecasts Bigger AI Boom
- Vladimir Zhirinovsky's highly methodical madness
- Photos of the Week: Hungry Fox, Plum Blossoms, Snow Rally
- When My Country Invaded Ukraine, I Faced a Choice: Give Me Propaganda or Give Me Death
- Rushdi Sarraj loved to record what others did not or would not see
- Hot Toys' Padawan Ahsoka Is Its Most Realistic Little Child Soldier Yet
- War in space is no longer science fiction
- This week's covers
- Why logistics are too important to be left to the generals
- Northern Ireland's peace process is not over
- Meet the Peruvian indigenous singer inspired by K-pop
- Sex and the Capital City
- Three female MPs given bodyguards after concerns over safety
- Jay Pasachoff travelled the world to catch the Moon eclipsing the Sun
- A powerful Irish film about the Great Famine reaches British cinemas
- Bournemouth vs. Man City Livestream: How to Watch English Premier League Soccer From Anywhere - CNET
- Martin Amis was the lurid chronicler of a whole generation
- The battle over South Africa's spicy-chicken market
- The Odysseus has become the first US spacecraft to land on the moon in 50 years
- How China's delivery drivers quietly fight to improve their lot
- New treatments are emerging for type-1 diabetes
- Raven - CI/CD Security Analyzer
- How to save China's economy
- The week around the world in 20 pictures
- Google court filing reveals new business details of DuckDuckGo and Neeva
- Nawaz Sharif returns to Pakistan, again
- Economic data, commodities and markets
- Economic data, commodities and markets
- Economic data, commodities and markets
- Economic data, commodities and markets
- Even as war rages in Gaza, Israel's Arabs are feeling more Israeli
- Asia's commercial heft helps keep Russia's war economy going
- A short history of the Arab-Israeli conflict
- Post-Brexit Britain is splurging more on state aid
- This week's covers
- Viral Video of Mike Lindell Driving While 'Hammered' Is Completely Fake
- The Ugandan state unlawfully detains a novelist
- Economic data, commodities and markets
- Miranda Bogen is creating solutions to help govern AI
- Two Nations, a Horrible Accident, and the Urgent Need to Understand the Laws of Space
- Elon Musk's X is especially vulnerable to an ad boycott
- Alienware Aurora R16 Review: I Can't Help But Enjoy Probing This Latest PC Design
- Was your degree really worth it?
- Why Yemen's Houthis are attacking ships in the Red Sea
- Northern Ethiopia is again sliding into starvation
- The Borderlands movie trailer has all the nuance of a Borderlands game
- Don't use smartwatches and rings that claim to measure blood sugar without needles, the FDA warns
- Germany's Christian Democrats are unsure whom to hug
- Business
- The US Congress remains far from the finish line of a budget deal
- Intel's CEO Says AI Is the Key to the Company's Comeback
- The challenges of steering a hypersonic plane
- Ofir Libstein had extraordinary dreams for his small patch
- Economic data, commodities and markets
- Singapore's biggest money-laundering case has links to Chinese gamblers
- The best films of 2021
- For China, Taiwan's elections are a looming crisis
- The Best Earbuds for Under $150
- Economic data, commodities and markets
- Google releases new open LLMs, Rivian lays off staff and Signal rolls out usernames
- Israeli settlers are causing mayhem in the West Bank
- Best Galaxy S24 Cases (2024): Screen Protectors, Chargers, and More
- Scientists Are Putting ChatGPT Brains Inside Robot Bodies. What Could Possibly Go Wrong?
- How much should TikTok fear a resurgent Donald Trump?
- A "Divine Comedy" ballet, 700 years after Dante's death
- America's Supreme Court is inclined to clamp down on regulators
- Ray Dalio is a monster, suggests a new book. Is it fair?
- Politics
- A flying car that anyone can use will soon go on sale
- Britain's marathon rail strikes may be nearing an end
- Gloria Allen ran a charm school for young trans women
- Hackers for sale: what we've learned from China's massive cyber leak
- Vivienne Westwood sowed never-ending revolution all through the fashion world
- Turkey faces a crucial election this summer
- Saudi Arabia wants to be the Saudi Arabia of minerals
- Why is the British Museum always in trouble?
- After 50 years, Wole Soyinka has returned to fiction
- Can Narendra Modi complete India's state-building project?
- Many AI researchers think fakes will become undetectable
- Ron DeSantis has some lessons for America's politicians
- Squadron Leader Johnny Johnson longed to give Hitler a bloody nose
- The many prices of carbon dioxide
- Latin America's most powerful new gang built a human-trafficking empire
- Black small businesses in LA are closing. That means fewer safe spaces for Black people
- Arts Calendar: Happenings for the Week of February 25
- Business
- America's border crisis in charts
- This week's cover
- Australia's energy transition is in trouble
- An AT&T Outage Is Wreaking Havoc on US Cellular Networks
- Why Writing by Hand Is Better for Memory and Learning
- We're hiring a Science and Technology Correspondent
- Europe's new plan to safeguard its economy
- Lula cosies up to Nicolás Maduro, Venezuela's autocrat
- Joe Biden's disappearing defence secretary
- 5 Takeaways From the South Carolina Republican Primary
- Shang-Chi's Destin Daniel Cretton Will Make the Naruto Movie
- Russia is attacking Ukraine's agricultural exports
- Economic data, commodities and markets
- A pair of Indian and Russian probes approach the Moon
- The death of Pope Benedict removes a problem for liberal Catholics
- 'Being a nun was the great love story of my life': Catherine Coldstream on why she joined – then fled – a convent
- Economic data, commodities and markets
- "Aftermath" is a piercing study of Germany after 1945
- Defying China, Taiwan elects William Lai Ching-te as president
- Economic data, commodities and markets
- The British government is not paying dementia enough attention
- AI's Unlikely Benefactor: Blackstone's 77-Year-Old CEO Steve Schwarzman
- States are becoming more brazen about killing foes abroad
- Green protectionism comes with big risks
- Anwar Ibrahim, Malaysia's prime minister, is wasting his opportunity
- A typically British way to smooth handovers of power
- Amazon to pay $1.9 million to settle claims of human rights abuses of contract workers
- Why fewer university students are studying Mandarin
- Covid learning loss has been a global disaster
- Gordon Moore's law was the spur that drove the digital revolution
- Your pay is still going up too fast
- Economic data, commodities and markets
- India's diaspora is bigger and more influential than any in history
- Xi Jinping is struggling to stamp out graft in the PLA
- Amba Kak creates policy recommendations to address AI concerns
- Matthew Perry changed the way America spoke
- How Britain lost its war on drugs
- Everything We Know (and Think We Know) About Star Wars' Project Necromancer
- Victoria Amelina explored a land of atrocities and secrets
- What Donald Trump can learn from the Big Mac index
- Meet Boris Nadezhdin, Vladimir Putin's brave challenger
- The effects on Turkey of Syria's civil war
- Why Central Americans migrate to the United States when they do
- Economic data, commodities and markets
- Boneheaded anti-immigration politicians are throttling globalisation
- Two books assess the fight against global corruption
- The booze industry reveals a lot about Kenya
- Sir Keir Starmer: bureaucrat first, politician second
- Latin America remains a playground for Russian intelligence
- Business
- Economic data, commodities and markets
- Russia is losing the battle for the Black Sea
- Brazil reckons with the life and legacy of an abolitionist
- An ancient rice bowl complicates the story of civilisation in India
- Xi Jinping is trying to fuse the ideologies of Marx and Confucius
- The simmering row over Spanish-language teaching in Catalan schools
- Intel's AI Reboot Is the Future of US Chipmaking
- Some forms of chronic pain are particularly mysterious
- From hypersonic missiles to undersea drones, the PLA is making leaps
- China will become less populous, more productive—and more pricey
- There's a Playdate games showcase on February 28
- Google promises to fix Gemini's image generation following complaints that it's 'woke'
- André Watts took both Liszt and Schubert to his heart
- February Social Security Payments: Have You Received Your Check Yet? - CNET
- South Africa's support for the Palestinian cause has deep roots
- The U.S. Military Is Monitoring Another High-Altitude Balloon
- What Is Genetic Testing? The Complete WIRED Guide
- "You will always be 0% prepared": Ukraine's refugees on life far from home
- Vast amounts of the world's shipping sails unseen
- What could bring Apple down?
- SNP to push for another Commons vote on ceasefire in Gaza
- Many family firms lack heirs. Unrelated help is at hand
- How to overcome the biggest obstacle to electric vehicles
- Antisemitism surges in France after the Hamas attacks on Israel
- The $100 Bill Is America's Most Common Currency, and Its Most Annoying
- Most children in poor countries are being failed by their schools
- 8 Best Deals: Streaming Devices, Smart TVs, and Projectors
- Are Ukraine's tactics working?
- Vladimir Putin is dragging the world back to a bloodier time
- TSMC is having more luck building in Japan than in America
- What does Xi Jinping want from Vladimir Putin?
- A cautionary tale from the streets of San Francisco
- Bangladesh's prime minister, Sheikh Hasina, wins a fifth term
- CloudMiner - Execute Code Using Azure Automation Service Without Getting Charged
- The mystery of Britain's dirt-cheap stockmarket
- The parable of Andy Street, the mayor for the West Midlands
- Oil traders are flocking to sanctions-free Venezuela
- Apple iOS 17.4: iMessage Gets Post-Quantum Encryption in New Update
- The magical thinking behind Britain's Rwanda bill
- Albert Woodfox found his true self in prison
- How not to botch the upcoming EU leadership reshuffle
- Macau, China's sin city, wants to be more like Las Vegas
- Will US-Indian relations be hurt by India's assassination scheme?
- At what age do you hit the peak of your career?
- Politics
- Can the Mediterranean become Europe's energy powerhouse?
- Politics will move further to the left in 2023
- Kidnappers are wreaking havoc in Nigeria
- Broadway is struggling to find its rhythm after the pandemic
- The Turkish opposition faces big obstacles to winning the election
- The Supreme Court hints it will keep Donald Trump on the ballot
- A wave of international rule-making threatens Caribbean tax havens
- A 40-year-old nuclear-fusion experiment bows out in style
- It's Apparently Easy to Crack the Apple Vision Pro's Front Screen
- What Is Cyberwar? The Complete WIRED Guide
- For Congo's next president, winning may be the easy part
- Univision, America's Spanish news giant, reaches out to Donald Trump
- It is time to divert Taiwan's trade and investment from China
- Economic data, commodities and markets
- The war in Gaza is exacerbating Egypt's economic collapse
- War-ravaged Somalia takes a big step towards normality
- What to do about an uptick in Americans unjustly held abroad
- Cannabis: The Complete WIRED Guide
- Thaksin Shinawatra joins Thailand's establishment
- South Korean politics is one big row about history
- What happens when it is too hot to work?
- A new archive preserves the creative legacy of the East Village
- Car firms are trying out new ways to sell mobility
- The mystery surrounding China's missing defence minister
- Politics
- A climber's story evokes classic mountaineering literature
- In Turkey, Erdogan's charges of Western hypocrisy stick
- Great Amazon Weekend Deals: Grab Yourself New Sheets, a Humidifier, Tools and More With These Deals - CNET
- Battlefront's New Classic Collection Is a Chance to Return to the Deadliest Bridge in Star Wars History
- What economists have learnt from the post-pandemic business cycle
- Fake Caviar Invented in the 1930s Could Be the Solution to Plastic Pollution
- Donald Tusk must undo years of populist subversion in Poland
- How an amateur football league in China took off
- Sources and acknowledgments
- What Google's antitrust defeat means for the app economy
- Xi Jinping plays social engineer
- The New Hot Climate Investment Is Heat Itself
- "Spencer", Pablo Larraín's Princess Diana fable, is less than the sum of its parts
- Insert coin
- Central-bank digital currencies are talked about more than coming to fruition
- How will Britons vote in the next election?
- Will TikTok's GoTo gambit save its Indonesian business?
- Madrid is booming. Growing while keeping its cool will be the tricky part
- An ancient whale-like animal may be the biggest to have ever lived
- Why Britain's Treasury must change its ways
- America may soon be in recession, according to a famous rule
- Economic data, commodities and markets
- The temptations of deferred removals
- How does Ron DeSantis dropping out change the Republican primary?
- Google pauses Gemini's ability to generate people after overcorrecting for diversity in historical images
- How Ecuador became Latin America's deadliest country
- Business
- DeSantis v Newsom: the presidential match-up that isn't
- Why Lula keeps meddling with Latin America's top oil company
- Politics and technology are pushing oil firms to cut methane
- China's ties with America are warming, a bit
- Abdel-Fattah al-Sisi wins another stage-managed election in Egypt
- Glaciers on volcanoes could serve as early-warning systems
- The plight of Christians in Bethlehem and Jerusalem predates the latest Gaza war
- Eiffel Tower reopens to visitors after strike by workers who complained of rust
- Asian Chip Stocks Gain After Nvidia Signals Booming AI Demand
- Check Out Google's Redesigned Login Page So You Don't Get Scammed
- Economic data, commodities and markets
- Xi Jinping and China face another tough year
- The insidious campaign to demolish mosques in India
- A mounting crisis of confidence confronts Olaf Scholz
- Brazil's biggest drug gang has gone global
- A northern mayor's left-wing challenge to Labour
- How to Use Quick Share on Android (2024)
- Intel's AI Reboot Is the Future of US Chipmaking
- Is Julius Malema the most dangerous man in South Africa?
- EV sales in Britain are disappointing expectations
- A comical effort by China's intelligence agency
- Renovation required
- Europe's generosity to Ukrainian refugees is not so welcome—in Ukraine
- Why is Israel using so many dumb bombs in Gaza?
- Wall Street is praying firms will start going public again
- Intel's AI Reboot Is the Future of US Chipmaking
- Elon Musk's X Gave Check Marks to Terrorist Group Leaders, Report Says
- Northern Ireland gets its government back
- Alexei Navalny, Russia's opposition leader, is missing in the gulag
- 17 Tips to Take Your ChatGPT Prompts to the Next Level
- India's top court upholds the central government's grab at Kashmir
- Could newborn neurons reverse Alzheimer's?
- Gina Lollobrigida's ambition was her strength and her weakness
- Russia is poised to take advantage of political splits in Ukraine
- Short-sellers are endangered. That is bad news for markets
- Why America's political parties are so bad at winning elections
- How Amos Vogel changed American film culture
- How to predict the outcome of a coin toss
- Economic data, commodities and markets
- Geert Mak takes stock of the past 20 years of European history
- Leak Reveals the Unusual Path of 'Urgent' Russian Threat Warning
- My Quest to Fix a Crashing Roku App Provides a Warning About AI
- Japanese men have an identity crisis
- America is trying to peg Israel's settlers back
- Trees alone will not save the world
- Radio telescopes could spot asteroids with unprecedented detail
- Live TV Is the New Streaming
- India's unprecedented love-in with the Middle East
- Women's (in)justice in India
- Jiang Zemin oversaw a wave of economic change, but not much political reform
- A growing industry is emerging to make philanthropy simpler
- A private Moon mission hopes to succeed where others have failed
- How a Rwandan gambit consumed the Conservative Party
- Spain shows regional nationalists make bad coalition partners
- Economic data, commodities and markets
- Negotiators are working on an Israel-Hamas cease-fire deal. Here's what to know
- Gustavo Petro, Colombia's left-wing president, is floundering
- 7 Best Theragun-Alternative Massage Guns (2024): Portable, Affordable, and Heat Therapy
- The WIRED Guide to Commercial Human Space Flight
- This Week in AI: Addressing racism in AI image generators
- PurpleKeep - Providing Azure Pipelines To Create An Infrastructure And Run Atomic Tests
- Latin America's left-wing experiment is a warning to the world
- Canada has a shortage of lifeguards
- Regulatory changes hint at what might be in store in a second Biden term
- Rolls-Royce Bullish on Outlook as Profits Jump
- Meet the shrewdest operators in today's oil markets
- Taiwan's opposition parties unite
- Much of Russia's intellectual elite has fled the country
- How independent is India's Supreme Court?
- Gilberto Rodríguez Orejuela once ran 80% of the world cocaine market
- Google Apologizes for Hurting White Peoples' Feelings
- New Moons Discovered Around Uranus and Neptune
- The far-right's favoured social-media platform plots a comeback
- Antarctica sea ice reaches alarming low for third year in a row
- Which will grow faster: India or Indonesia?
- What Is Net Neutrality? The Complete WIRED Guide
- I Love Charlotte, the Pregnant Stingray Who's Doing It All Herself
- Football attracts Saudi investment to England's north-east
- A new psychological history of the cold war
- KAL's cartoon
- How two teams plan to smash the world sailing-speed record
- London's riotous pedicabs are about to be regulated
- Parts of Colombia are now awash with cocaine
- It was hard for any viewer to look away from Sidney Poitier
- To understand Britain, watch "Homes Under the Hammer"
- The deaths-of-despair narrative is out of date
- Should women's football have different rules from men's?
- Economic data, commodities and markets
- Newark may have found a fix for chronic homelessness
- Guatemala's new president promises a better sort of government
- The second-gen Apple HomePod is down to $285 in a rare sale
- US men and dating: share your experience
- China is leading the challenge to incumbent carmakers
- Economic data, commodities and markets
- Climate change is harder on less educated people
- KAL's cartoon
- Investors may be getting the Federal Reserve wrong, again
- Faulty door plugs open old wounds at Boeing
- Drone Delivery Sparks Chaos in Hilarious Sci-Fi Novel Deliver Us
- The EU's €50bn package for Ukraine is a far cry from its rhetoric
- Canada's wildfires have burnt an area 16 times larger than normal
- Game of Thrones' Creators Really Did Want to Finish With 3 Movies
- It's not the Trump Party quite yet
- Screen Actors Guild awards 2024: Oppenheimer dominates with big wins
- Gas's future looks cloudy as demand and prices tumble
- Will China leave behind its economic woes in 2024?
- Conservative towns in liberal American states want to ban abortion
- Lee Jae-myung, South Korea's opposition leader, survives a stabbing
- A familiar ring: Hull's 1960s cream telephone boxes – in pictures
- Confusion reigns in Pakistan's rigged election
- The Finnish miracle: how the country halved its suicide rate – and saved countless lives
- Best AirPods Deals: Save Up to $45 on Beats, AirPods 2 and AirPods Max - CNET
- What is Virtual Reality (VR)? The Complete WIRED Guide
- Cashless talk
- Why Xi Jinping sounds friendlier to America
- 10 Tasty Horror Movies (Including Thanksgiving) Streaming on Netflix
- The Hindu right's pro-cow policies are terrible for India's cows
- Humane pushes Ai Pin ship date to mid-April
- Politics
- The making of a PowerPoint slide
- Video: Busting globalisation myths
- Business
- An interview with Hsiao Bi-khim, candidate for Taiwan's vice-president
- Myanmar's junta suffers startling defeats
- How China's public views Taiwan's elections
- How will Russia remember Alexei Navalny? – video explainer
- Investing in commodities has become nightmarishly difficult
- Meet the Knights of Malta
- Married women in Japan are re-entering the labour market
- The Hedge Funds That Changed the Game
- A bumpy road for EV manufacturers
- We started a group chat to help fellow doctors in Gaza. Then it went quiet
- This week's covers
- Economic data, commodities and markets
- Tech Job Interviews Are Out of Control
- Help, My Friend Got Me a Dumb AI-Generated Present
- Four charts that highlight this summer's freakish temperatures
- Some of the new king's realms may become republics
- How the war split the mafia
- A majority of congressmen want more military aid for Ukraine
- A new type of jet engine could revive supersonic air travel
- For Car Thieves, Toronto Is a 'Candy Store,' and Drivers Are Fed Up
- China's leaders are flailing as markets drop
- How the culture wars came for grizzly bears
- China is winning Africa's "white-gold" rush for lithium
- Google's Chess Experiments Reveal How to Boost the Power of AI
- A new book explains the tragic failure of Boeing's 737 MAX
- Turkey's sluggish post-earthquake reconstruction
- Could China, Russia's "no-limits" friend, help rebuild Ukraine?
- Life and death in a Christmas tree
- Love, frugality and home-grown flowers are in the air
- The women's Euros are selling out stadiums
- SharpShares - Multithreaded C# .NET Assembly To Enumerate Accessible Network Shares In A Domain
- Economic data, commodities and markets
- The rise of the TikTok news anchor
- Business
- It's not just Paris. Bedbugs are resurgent everywhere
- Will America manage a soft landing in 2024?
- KAL's cartoon
- The pace of Israel's war in Gaza far exceeds previous conflicts
- America has had a Cuban agent in its midst for 42 years
- A new biography explains the genius of John von Neumann
- Humidifiers vs Dehumidifiers vs Purifiers: Which One Do I Actually Need?
- Africa's coups are part of a far bigger crisis
- Annual inflation of 114% is pushing Argentina to the right
- Physicists Measure Gravity of Smallest Mass Yet
- Economic data, commodities and markets
- Weather tracker: Contrasts in cold and heat break records in China
- Senate GOP campaign arm urges candidates to back IVF after Alabama court ruling
- At a UN review, China basks in the flattery of friendly countries
- The Industrial Designer behind the N95 Mask
- Two by-election defeats spell deep trouble for the Tories
- How China is making the burger its own
- Sculptures about to Land on the Moon Join a Long History of Lunar Art
- A supposed haven in Sudan falls to a genocidal militia
- KAL's cartoon
- How to speak like a member of Congress
- After two years of war, Ukrainians are becoming pessimistic
- This week's covers
- Why does landlocked Eswatini have a ship registry?
- Google Tweaked Search to Comply With EU Rules. Yelp Says It Makes Results Even More Unfair
- Economic data, commodities and markets
- How to nobble a political rival in Africa and get away with it
- Ted Pick takes charge of Morgan Stanley
- Shock and awe as America strikes Iran's proxies
- How ransomware could cripple countries, not just companies
- Xi Jinping's grip on Chinese enterprise gets uncomfortably tight
- The obesity pay gap is worse than previously thought
- The energy transition could make India even more unequal
- Ukraine's army is struggling to find good recruits
- Trouble Already for Odysseus at the Moon's South Pole
- Some British universities have become remarkably racially diverse
- Anti-woke activists are winning the culture war in America
- Economic data, commodities and markets
- Some Apple Vision Pro units reportedly developed a similar hairline crack on the front glass
- The crime drama Russia and Ukraine want to ban
- Lawn bowls is in decline. Can it make a comeback?
- How the world economy learned to love chaos
- Pelé went from poverty to football superstardom
- 2024 is a giant test of nerves for democracy
- Beware the Top Google Search Result. It Might Be Wrong.
- Argentina's presidential election delivers a surprise result
- Economic data, commodities and markets
- Biden's chances of re-election are better than they appear
- Generative AI generates tricky choices for managers
- New ways to pay for research could boost scientific progress
- How Democrats Could Disqualify Trump If the Supreme Court Doesn't
- Economic data, commodities and markets
- Ukraine's counter-offensive is speeding up
- Wall Street's Latest Pitch Is a Contradiction: Private IPOs
- How a Shifting AI Chip Market Will Shape Nvidia's Future
- Trump's donor numbers fall by 200,000 compared with 2019
- 'We've always been here': Lily Gladstone shares the Native Hollywood talent you need to know
- Cousin marriage is probably fine in most cases
- How Russia is trying to win over the global south
- If Venezuela's elections were fair, this would be the front-runner
- Latin America's single mothers are being left behind
- Conspiracy Theories Run Wild Amid Mass U.S. Cell Outage
- Argentina could get its first libertarian president
- Economic data, commodities and markets
- Armies are re-learning how to fight in cities
- Economic data, commodities and markets
- Is it cheaper to rent or buy property?
- Maya Widmaier-Picasso helped to revive her father's creativity
- What happens to Gaza after the war?
- Israel needs to resist irrational retaliation
- Is Japan's economy at a turning point?
- China is shoring up the great firewall for the AI age
- How San Francisco staged a surprising comeback
- Elections in Ecuador and Guatemala suggest an anti-incumbent surge
- KAL's cartoon
- Why Chinese companies are flocking to Mexico
- Russia is starting to make its superiority in electronic warfare count
- The three steps on America's ladder of military escalation
- India close to series win after Jurel and Ashwin turn tables on England
- Elon Musk's messiah complex may bring him down
- The many contradictions of Sam Altman
- Is This New 50-Year Battery for Real?
- Streaming services are helping Arab producers liven up television
- Why no one is winning the war in Ukraine – video explainer
- Our Carrie Bradshaw index: Where Americans can afford to live solo
- Anne Neuberger, a Top White House Cyber Official, Sees the 'Promise and Peril' in AI
- Evidence mounts that Ukrainian forces are in Sudan
- Crying in Apple Vision Pro Is No Laughing Matter
- Why diplomacy over Sudan, Africa's enduring nightmare, is stuck
- Gradually, the besieged city of Bakhmut is being abandoned by everyone
- Where Donald Trump still looks vulnerable
- Politics
- Izumi Kenta wants to shake up Japan's opposition
- Enough With the Stanley Cup. These 3 Water Bottles Are Actually Good.
- Is there a genetic link between endometriosis and the brain?
- A key part of Obamacare is in jeopardy
- Vin Diesel's Sticking With Fast & Furious All the Way to The End
- Where democracy is most at risk
- FTC concludes Twitter didn't violate data security rules, in spite of Musk's orders
- Hebe de Bonafini lived through the lives of her sons
- Bindeshwar Pathak realised that India's future depended on toilets
- House Republicans fear Trump too much to aid Ukraine
- The future of philanthropy will involve a mix of different approaches
- Three surprises that could inflame commodity markets in 2024
- Israel strikes a hostage deal, but says the Gaza war isn't over
- Comics Writer Ed Brubaker Talks Crime, Drugs, Maps, and Growing Up
- Colombia vows to put nature at the heart of global environmental negotiations
- How the Rosetta Stone was deciphered
- The battle with China is psychological as much as physical
- Business
- Why New York wants to be more like London
- Farmers in Europe: are you taking part in the protests?
- Illegal gold is booming in South America
- The Senate blocked aid for Ukraine. Now what?
- How to transport a rhino
- Britain needs more houses. Does the industry want to build them?
- Economic data, commodities and markets
- Ukrainian refugees remain in limbo
- The dangers of carrying a child for someone else in China
- How the Mediterranean could become a green-energy powerhouse
- The big picture: Petra Bašnáková's intimate portrait of life among the Palestinian Bedouins
- Global democratic backsliding seems real, even if it is hard to measure
- Nvidia Hits $2 Trillion Valuation
- Microsoft is giving Windows Photos a boost with a generative AI-powered eraser
- Economic data, commodities and markets
- The best albums of 2021
- Is Ukraine's offensive stalling?
- Justin Schmidt made a lifetime study of insects that attack us
- Dervla Murphy let nothing stand in the way of adventure
- Neuralink's First Brain Implant Is Working. Elon Musk's Transparency Isn't
- Wall Street's Latest Pitch Is a Contradiction: Private IPOs
Subscribe to:
Posts (Atom)